Recombinant Full Length Orientia Tsutsugamushi 56 Kda Type-Specific Antigen Protein, His-Tagged
Cat.No. : | RFL30692OF |
Product Overview : | Recombinant Full Length Orientia tsutsugamushi 56 kDa type-specific antigen Protein (P37915) (23-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Orientia tsutsugamushi (Rickettsia tsutsugamushi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-532) |
Form : | Lyophilized powder |
AA Sequence : | IELGEEGLECGPYAKVGVVGGMITGVESARLDPADAEGKKHLSLTNGLPFGGTLAAGMTI APGFRAEIGVMYLTNITAQVEEGKVKADSVGETKADSVGGKDAPIRKRFKLTPPQPTIMP ISIAVRDFGIDIPNQTSAASTSRSLRLNDEQRAAARIAWLKNCAGIDYRVKNPNDPNGPM VINPILLNIPQGNPNPVGNPPQRANPPAGFAIHNHEQWRHLVVGLAALSNANKPSASPVK VLSDKITQIYSDIKHLADIAGIDVPDTSLPNSASVEQIQNKMQELNDLLEELRESFDGYL GGNAFANQIQLNFVMPQQAQQQGQGQQQQAQATAQEAVAAAAVRLLNGNDQIAQLYKDLV KLQRHAGIKKAMEKLAAQQEEDAKNQGEGDCKQQQGTSEKSKKGKDKEAEFDLSMIVGQV KLYADVMITESVSIYAGVGAGLAYTSGKIDNKDIKGHTGMVASGALGVAINAAEGVYVDI EGSYMYSFSKIEEKYSINPLMASVSVRYNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Orientia tsutsugamushi 56 kDa type-specific antigen |
Synonyms | 56 kDa type-specific antigen; TSA; 56 kDa scrub typhus antigen; STA56; TSK56 |
UniProt ID | P37915 |
◆ Recombinant Proteins | ||
CHMP4C-677R | Recombinant Rhesus Macaque CHMP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
MAB21L1-180H | Recombinant Human MAB21L1 Protein, His-tagged | +Inquiry |
SAP014A-004-1491S | Recombinant Staphylococcus aureus (strain: CDC58, other: HA-MRSA) SAP014A_004 protein, His-tagged | +Inquiry |
ADIPOQ-1061H | Recombinant Human Adiponectin Protein | +Inquiry |
EIF3M-394H | Recombinant Human EIF3M protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
Phosphorylase B-49R | Active Native Rabbit Phosphorylase B | +Inquiry |
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPC-4726HCL | Recombinant Human LIPC 293 Cell Lysate | +Inquiry |
RAX-2492HCL | Recombinant Human RAX 293 Cell Lysate | +Inquiry |
C3orf18-8052HCL | Recombinant Human C3orf18 293 Cell Lysate | +Inquiry |
LAT-4816HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
UCK2-531HCL | Recombinant Human UCK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Orientia tsutsugamushi 56 kDa type-specific antigen Products
Required fields are marked with *
My Review for All Orientia tsutsugamushi 56 kDa type-specific antigen Products
Required fields are marked with *
0
Inquiry Basket