Recombinant Human EIF3M protein, GST-tagged

• Cat.No.: EIF3M-394H
• Product Overview: Recombinant Human EIF3M(1 a.a. - 374 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 374 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 68.9 kDa
• AA Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILE PDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKW ISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLT LKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: EIF3M eukaryotic translation initiation factor 3, subunit M [ Homo sapiens ]
• Official Symbol: EIF3M
• Synonyms: EIF3M; eukaryotic translation initiation factor 3, subunit M; PCI domain containing 1 (herpesvirus entry mediator) , PCID1; eukaryotic translation initiation factor 3 subunit M; eIF3m; FLJ29030; GA17; hfl B5; B5 receptor; fetal lung protein B5; dendritic cell protein; PCI domain-containing protein 1; PCI domain containing 1 (herpesvirus entry mediator); B5; PCID1; hfl-B5
• Gene ID: 10480
• mRNA Refseq: NM_006360
• Protein Refseq: NP_006351
• MIM: 609641
• UniProt ID: Q7L2H7
• Chromosome Location: 11p13
• Function: protein binding; contributes_to translation initiation factor activity