Recombinant Full Length Oligotropha Carboxidovorans Atp Synthase Subunit B/B'(Atpg) Protein, His-Tagged

• Cat.No.: RFL12566OF
• Product Overview: Recombinant Full Length Oligotropha carboxidovorans ATP synthase subunit b/b'(atpG) Protein (B6JDC8) (1-187aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Oligotropha carboxidovorans
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-187)
• Form: Lyophilized powder
• AA Sequence: MAESHATGTTTHTEVPHGKPEFPPFNKDTFASQLVSFAIAFALLYVIVSRFALPRVGGVI KTREGTIEKDLAEAQAFRDESDLALKAYETELAAARTRAQAIGSETRDTLAAQSDAERKA VELSLSAKLAEAEKTISDMRTKAMGNVKAIAADATSAIVQQLSGTAPDAQLIDRAVDASL KGGRDAA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: atpF2
• Synonyms: atpF2; atpG; OCAR_4698; OCA5_c32520; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
• UniProt ID: B6JDC8