Recombinant Full Length Odontella Sinensis Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL17792OF |
Product Overview : | Recombinant Full Length Odontella sinensis ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (P49825) (1-644aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Odontella sinensis (Marine centric diatom) (Biddulphia sinensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-644) |
Form : | Lyophilized powder |
AA Sequence : | MNDNKNNTVRNLLIGIALLSGISLTAKKFDLIGVQGSESGKNINQVNPNVISSKMTYGRF LEYLEMGWVNQVDLYDNSRNAIVQASSPELGNRPQTIRVEIPVGASQLIQKLKEYNIDFD AHPAEQKNIFVNILSNILLPIIFITGLVYLFQNSENFGGGSGQSPMSLGKSTARFERRPD TGVSFKDIAGIDEAKTEFEEIVSFLKEPDKYTIVGAKIPKGILLVGPPGTGKTLLAKAIA NEADVPFFSVAGSEFVEMFIGIGAARVRDLFKKASENAPCIVFIDEIDAVGRERGAGVGG GNDEREQTLNQLLTEMDGFKENKGVIVVGATNRADILDAALLRPGRFDRQVTVNLPDRLG RVGILKVHARNKPLGEDVSLVQLANRTPGFSGADLANLLNEAAILATRYKKSSITKNEVN EAADRIIGGIAGAPMEDTKNKRLIAYHEVGHAITGSVLKSHDEVEKITLTPRGGAKGLTW FTPEEDQSLLSRSALLARIITTLGGRAAEQVIFGEPEVTTGASSDLQQVTNLARQMVTRF GMSNIGPLALEDESTGQVFLGGNMASGSEYAENIADRIDDEVRKIITYCYEKAIEIVLDN RVVIDLIVEKLLDKETMDGDEFRELLSTYTILPNKNIPYVSKFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; ycf25; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | P49825 |
◆ Recombinant Proteins | ||
PPP2R5C-3521C | Recombinant Chicken PPP2R5C | +Inquiry |
RFL20912PF | Recombinant Full Length Polyodon Spathula Cytochrome C Oxidase Subunit 1(Mt-Co1) Protein, His-Tagged | +Inquiry |
CDC25B-0916H | Recombinant Human CDC25B Protein, GST-Tagged | +Inquiry |
ANKRD28-545M | Recombinant Mouse ANKRD28 Protein, His (Fc)-Avi-tagged | +Inquiry |
RLN-4544D | Recombinant Dog RLN protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
MFGE8-289B | Native MFG-E8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHKA-7535HCL | Recombinant Human CHKA 293 Cell Lysate | +Inquiry |
RBPJ-2453HCL | Recombinant Human RBPJ 293 Cell Lysate | +Inquiry |
VPS18-397HCL | Recombinant Human VPS18 293 Cell Lysate | +Inquiry |
PYCR2-2647HCL | Recombinant Human PYCR2 293 Cell Lysate | +Inquiry |
TRPA1-1841HCL | Recombinant Human TRPA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket