Recombinant Full Length Polyodon Spathula Cytochrome C Oxidase Subunit 1(Mt-Co1) Protein, His-Tagged
Cat.No. : | RFL20912PF |
Product Overview : | Recombinant Full Length Polyodon spathula Cytochrome c oxidase subunit 1(mt-co1) Protein (P29650) (1-158aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Polyodon spathula (North American paddlefish) (Squalus spathula) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-158) |
Form : | Lyophilized powder |
AA Sequence : | HLFWFFGHPEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHM FTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWDTPLLWALGFIFLFTVGG LTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mt-co1 |
Synonyms | mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment |
UniProt ID | P29650 |
◆ Recombinant Proteins | ||
PGF-0643H | Recombinant Human PGF protein, GST-tagged | +Inquiry |
PGSE-2970B | Recombinant Bacillus subtilis PGSE protein, His-tagged | +Inquiry |
SRPRB-5402R | Recombinant Rat SRPRB Protein, His (Fc)-Avi-tagged | +Inquiry |
DRAP1-1954R | Recombinant Rat DRAP1 Protein | +Inquiry |
FAM115E-2211R | Recombinant Rat FAM115E Protein | +Inquiry |
◆ Native Proteins | ||
MB-236B | Native Bovine Myoglobin | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF181-1522HCL | Recombinant Human RNF181 cell lysate | +Inquiry |
ARHGAP26-111HCL | Recombinant Human ARHGAP26 cell lysate | +Inquiry |
NAP1L5-3973HCL | Recombinant Human NAP1L5 293 Cell Lysate | +Inquiry |
COX6C-7327HCL | Recombinant Human COX6C 293 Cell Lysate | +Inquiry |
NXNL1-1240HCL | Recombinant Human NXNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mt-co1 Products
Required fields are marked with *
My Review for All mt-co1 Products
Required fields are marked with *
0
Inquiry Basket