Recombinant Full Length Nostoc Sp. Upf0754 Membrane Protein Alr5253(Alr5253) Protein, His-Tagged
Cat.No. : | RFL6858NF |
Product Overview : | Recombinant Full Length Nostoc sp. UPF0754 membrane protein alr5253(alr5253) Protein (Q8YLP3) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MPNPKKTVNWSHLWLYVSPPILGGIIGYFTNDIAIKMLFRPYRAIYIGGRRVPFTPGLIP RNQERLAKNISDTIMGSLLTPDELQKLARRLLKTERVQGAILWLLQLAIDQIKTDTDKKS AKIVAGILRDLIGESLPRLLKVLARREDFLEAQINQIFDQILLELQLSEEQASRLADWFL EVVLPPDVIRQAIVDFLTDRTIQIIDESFREKTSGTYWVVANLFGLRNTLTRLRTFCLDE KEATNNRLTELIQDLQMRDRFRKILQNLTLQNLPIGTVRQLRKTTRETVRQYVQTSGSDL LQGLTDSINWENIAELLLNRLSNSPVVISSLEVVSQELALILERYLEKDLEAIVAQVIPI LSIDQVIVDRVKSTSPADLEAAIEGIVKNELQAIVSLGGILGLIVGLFQTAFFIFSQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alr5253 |
Synonyms | alr5253; UPF0754 membrane protein alr5253 |
UniProt ID | Q8YLP3 |
◆ Recombinant Proteins | ||
SMN1-458H | Recombinant Human SMN1 Protein, His-tagged | +Inquiry |
SUMO2-1336S | Recombinant Human SUMO2 Protein (M1-Y95), Tag Free | +Inquiry |
UTP25-5261H | Recombinant Human UTP25 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSD17B12B-10014Z | Recombinant Zebrafish HSD17B12B | +Inquiry |
ST6GALNAC1-15H | Active Recombinant Human ST6GALNAC1 Protein (AA 36-600), N-6×His/GFP tagged | +Inquiry |
◆ Native Proteins | ||
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
hypogaea 2S-156A | Native Arachis hypogaea 2S protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT12-9090HCL | Recombinant Human ACOT12 293 Cell Lysate | +Inquiry |
FOXJ2-6154HCL | Recombinant Human FOXJ2 293 Cell Lysate | +Inquiry |
XPOT-1939HCL | Recombinant Human XPOT cell lysate | +Inquiry |
HARS2-5634HCL | Recombinant Human HARS2 293 Cell Lysate | +Inquiry |
Eye-463C | Cat Eye Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All alr5253 Products
Required fields are marked with *
My Review for All alr5253 Products
Required fields are marked with *
0
Inquiry Basket