Recombinant Full Length Nostoc Sp. Filament Integrity Protein Frac(Frac) Protein, His-Tagged
Cat.No. : | RFL22273NF |
Product Overview : | Recombinant Full Length Nostoc sp. Filament integrity protein fraC(fraC) Protein (P46078) (1-179aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-179) |
Form : | Lyophilized powder |
AA Sequence : | MFEDLTIPRIWPIGAILFNLLFLLIAIPIEGYIYHRRLNFDKKTSIFYAIAVNSFSGVIG WVIFFFVEPVLPVPIKAELINYIFFNIFRSTNTQGVLIFTTFIIFFSTFLMKFFLLRLFV FTLSEDIGKKQEEPQPFYRQKVRFISRIRLQDTNLVTTTLIANSLSYTAITIILLIRNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fraC |
Synonyms | fraC; alr2392; Filament integrity protein FraC |
UniProt ID | P46078 |
◆ Recombinant Proteins | ||
RFL1633SF | Recombinant Full Length Photosystem Ii 22 Kda Protein, Chloroplastic(Psbs) Protein, His-Tagged | +Inquiry |
YLXW-3049B | Recombinant Bacillus subtilis YLXW protein, His-tagged | +Inquiry |
MAPRE1-3235R | Recombinant Rat MAPRE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC34A2-5411H | Recombinant Human SLC34A2 Protein (Met1-Leu104), N-His tagged | +Inquiry |
CEP55L-2902Z | Recombinant Zebrafish CEP55L | +Inquiry |
◆ Native Proteins | ||
IgG2-230H | Native Human Immunoglobulin G2 (IgG2) | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTDC1-5706HCL | Recombinant Human GTDC1 293 Cell Lysate | +Inquiry |
FAM167A-6411HCL | Recombinant Human FAM167A 293 Cell Lysate | +Inquiry |
ACVR1B-1356CCL | Recombinant Cynomolgus ACVR1B cell lysate | +Inquiry |
MAP3K13-1055HCL | Recombinant Human MAP3K13 cell lysate | +Inquiry |
EDEM2-862HCL | Recombinant Human EDEM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fraC Products
Required fields are marked with *
My Review for All fraC Products
Required fields are marked with *
0
Inquiry Basket