Recombinant Full Length Vibrio Cholerae Serotype O1 Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL31253VF |
Product Overview : | Recombinant Full Length Vibrio cholerae serotype O1 Membrane protein insertase YidC(yidC) Protein (A5F484) (1-541aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio cholerae serotype O1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-541) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQNV AAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQGHQFIAQSGL VGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRGSYAVDV VFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFDDMKDRN LSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGDMGIRTPNKTIANGDKAE FEATLWVGPKLQDQMAATAPNLDLVVDYGWLWFIAKPLHWLLSVIQTFVGNWGVAIICLT FIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQRMSQEMMELYKKEKVNPLGG CLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYYILPLLMGASMFVIQKMS PTTITDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVSNIVTLIQQTLIYKALEKKGLHS K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; VC0395_A2514; VC395_0176; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | A5F484 |
◆ Recombinant Proteins | ||
MUC16-5334H | Recombinant Human MUC16 Protein (Met13360-Gln14347), N-His tagged | +Inquiry |
VCBP1-1538B | Recombinant Branchiostoma floridae VCBP1 Protein (Ala16-Ala333), C-His tagged | +Inquiry |
GOLGA3-2053H | Recombinant Human GOLGA3 Protein, MYC/DDK-tagged | +Inquiry |
DHBF-0501B | Recombinant Bacillus subtilis DHBF protein, His-tagged | +Inquiry |
FN1-35H | Recombinant Human FN1 protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10C-893HCL | Recombinant Human TNFRSF10C 293 Cell Lysate | +Inquiry |
HLA-DQA2-5494HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
TRDD3-1819HCL | Recombinant Human TRDD3 cell lysate | +Inquiry |
SAMSN1-2070HCL | Recombinant Human SAMSN1 293 Cell Lysate | +Inquiry |
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket