Recombinant Full Length Chlorobium Tepidum Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL19450CF |
Product Overview : | Recombinant Full Length Chlorobium tepidum Membrane protein insertase YidC(yidC) Protein (Q8KGG2) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium tepidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MDRNSVIGFALIAAIMIVWLQFMKPEQKLGLEKAAASREAVQKTPAAALPAPSAAVAAAA RADSLGSFAQASVGTEKTITVSNDLFTATLSSKGATLKSLVLKKHLDGNRKPFNLISASD KGALSMLFLSSDGKKIDTRDLYFRSLDAKTTETVTGKEKLSVSYVLDVDATRSIQITYTF TGDSYVVDYDLKLNGFGSSIAGNEYQLDWDGGLNYSEKDQVDESHNAIASAYLGGSVVKL DAKDAKKTWQDEESGKAQWVAVRNKYFVAAIMPQRTTDGIYLHGTKKDGSDFKNYVAALK MSFPAGQQSVDDHYRLYVGPLDYNTVKSLNADLEKIMDFGWDWLTRPFAEYLILPIFNWM NKYVTNYGLIIIIFAFLIKLVTWPLSLASTKSMKKMSALQPVMKELQEKYKDNPAKLQSE LGRIYKEAGVNPLGGCLPTVIQMPLLFAMFYVFRSSIQLRQHGFLWVKDLSVPDSVYHFA FKLPLYGDHIAIMPILMAVTVFFQQKITPNAQSNEQTKIMMWLFPAMMLFFFNNMPAGLA LYYLMFNIFSVAQQAYMNATITDEEKAAAAMQVAAATKPAQSAKKGGKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; CT0006; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q8KGG2 |
◆ Recombinant Proteins | ||
KRTAP12-1-1550H | Recombinant Human KRTAP12-1 | +Inquiry |
LRRC32 & TGFB1-2141H | Recombinant Human LRRC32 & TGFB1 protein, His-Avi-tagged | +Inquiry |
EPHA7-551H | Active Recombinant Human EPHA7 Protein, Fc Chimera | +Inquiry |
Ubl5-6804M | Recombinant Mouse Ubl5 Protein, Myc/DDK-tagged | +Inquiry |
SENP2-0889H | Recombinant Human SENP2 Protein (D363-L589), Tag Free | +Inquiry |
◆ Native Proteins | ||
S-52H | Native Human Protein S | +Inquiry |
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCGF2-3382HCL | Recombinant Human PCGF2 293 Cell Lysate | +Inquiry |
BLZF1-8439HCL | Recombinant Human BLZF1 293 Cell Lysate | +Inquiry |
Epididymus-21H | Human Epididymus Tissue Lysate | +Inquiry |
HEXB-756HCL | Recombinant Human HEXB cell lysate | +Inquiry |
Kidney-465C | Cat Kidney Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket