Recombinant Full Length Nitrate/Nitrite Sensor Protein Narx(Narx) Protein, His-Tagged
Cat.No. : | RFL31689EF |
Product Overview : | Recombinant Full Length Nitrate/nitrite sensor protein narX(narX) Protein (P0AFA3) (1-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-598) |
Form : | Lyophilized powder |
AA Sequence : | MLKRCLSPLTLVNQVALIVLLSTAIGLAGMAVSGWLVQGVQGSAHAINKAGSLRMQSYRL LAAVPLSEKDKPLIKEMEQTAFSAELTRAAERDGQLAQLQGLQDYWRNELIPALMRAQNR ETVSADVSQFVAGLDQLVSGFDRTTEMRIETVVLVHRVMAVFMALLLVFTIIWLRARLLQ PWRQLLAMASAVSHRDFTQRANISGRNEMAMLGTALNNMSAELAESYAVLEQRVQEKTAG LEHKNQILSFLWQANRRLHSRAPLCERLSPVLNGLQNLTLLRDIELRVYDTDDEENHQEF TCQPDMTCDDKGCQLCPRGVLPVGDRGTTLKWRLADSHTQYGILLATLPQGRHLSHDQQQ LVDTLVEQLTATLALDRHQERQQQLIVMEERATIARELHDSIAQSLSCMKMQVSCLQMQG DALPESSRELLSQIRNELNASWAQLRELLTTFRLQLTEPGLRPALEASCEEYSAKFGFPV KLDYQLPPRLVPSHQAIHLLQIAREALSNALKHSQASEVVVTVAQNDNQVKLTVQDNGCG VPENAIRSNHYGMIIMRDRAQSLRGDCRVRRRESGGTEVVVTFIPEKTFTDVQGDTHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | narX |
Synonyms | narX; Z1998; ECs1727; Nitrate/nitrite sensor protein NarX |
UniProt ID | P0AFA3 |
◆ Recombinant Proteins | ||
RFL16067DF | Recombinant Full Length Dehalococcoides Sp. Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
PPT2-6077Z | Recombinant Zebrafish PPT2 | +Inquiry |
SAMD7-6514H | Recombinant Human SAMD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HINTW-6254C | Recombinant Chicken HINTW | +Inquiry |
TNFSF4-0589H | Active Recombinant Human TNFSF4 protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
TF-135R | Native Rabbit Transferrin | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRDM7-2884HCL | Recombinant Human PRDM7 293 Cell Lysate | +Inquiry |
NFX1-3842HCL | Recombinant Human NFX1 293 Cell Lysate | +Inquiry |
Melanoma-342H | Human Melanoma Lysate | +Inquiry |
HELLS-5589HCL | Recombinant Human HELLS 293 Cell Lysate | +Inquiry |
MAPK1-001MCL | Recombinant Mouse MAPK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All narX Products
Required fields are marked with *
My Review for All narX Products
Required fields are marked with *
0
Inquiry Basket