Recombinant Full Length Nicotiana Tabacum Cytochrome B-C1 Complex Subunit Rieske-4, Mitochondrial Protein, His-Tagged
Cat.No. : | RFL12144NF |
Product Overview : | Recombinant Full Length Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4, mitochondrial Protein (P51134) (25-236aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tabacum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-236) |
Form : | Lyophilized powder |
AA Sequence : | SSNSVSHAHDMGLVPDLPPTVAAIKNPTSKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLVRLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTED DINLANSVDLGSLRDPQQDAERVKSPEWLVVIGVCTHLGCIPLPNAGDFGGWFCPCHGSH YDISGRIRKGPAPYNLEVPTYSFLEENKLLIG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4, mitochondrial |
Synonyms | Cytochrome b-c1 complex subunit Rieske-4, mitochondrial; Complex III subunit 5-4; Rieske iron-sulfur protein 4; RISP4; Ubiquinol-cytochrome c reductase iron-sulfur subunit 4 |
UniProt ID | P51134 |
◆ Native Proteins | ||
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHI3L1-2521HCL | Recombinant Human CHI3L1 cell lysate | +Inquiry |
TBX22-1200HCL | Recombinant Human TBX22 293 Cell Lysate | +Inquiry |
DIP2C-480HCL | Recombinant Human DIP2C cell lysate | +Inquiry |
SPRYD4-1488HCL | Recombinant Human SPRYD4 293 Cell Lysate | +Inquiry |
ARPIN-82HCL | Recombinant Human ARPIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4, mitochondrial Products
Required fields are marked with *
My Review for All Nicotiana tabacum Cytochrome b-c1 complex subunit Rieske-4, mitochondrial Products
Required fields are marked with *
0
Inquiry Basket