Recombinant Full Length Arabidopsis Thaliana Probable Pectinesterase/Pectinesterase Inhibitor 21(Pme21) Protein, His-Tagged
Cat.No. : | RFL9228AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable pectinesterase/pectinesterase inhibitor 21(PME21) Protein (Q8GX86) (1-669aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-669) |
Form : | Lyophilized powder |
AA Sequence : | MSYGYDDESKRKRRYIVITISSVLLISMVVAVTVGVSLNKHDGDSKGKAEVNASVKAVKD VCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQKDSRTR MALDQCKELMDYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQGT QGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLNSRRLLAEGFPSWVDQRGR KLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKKRNTTFVVHIKAGLYKEYVQVN KTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIVGNYFIAKNIGFENTAGAIKHQ AVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDAAAVFQNCTLL VRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDYLAVKETSKAYLGRPWKEYSRT IIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPGSALANRVTWAGIKTLSEEDIL KFTPAQYIQGDDWIPGKGVPYTTGLLAGNPAAATTTPSVSAAAPGFSTFTDTSGADSIAP TASPAASPESSISMAYTGTASPESSIKVSSSTETASPESSFTEASTASPESSIMVASTES SGSFFSMFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PME21 |
Synonyms | PME21; ARATH21; At3g05610; F18C1.12; Probable pectinesterase/pectinesterase inhibitor 21 [Includes: Pectinesterase inhibitor 21; Pectin methylesterase inhibitor 21; Pectinesterase 21; PE 21; Pectin methylesterase 21; AtPME21] |
UniProt ID | Q8GX86 |
◆ Recombinant Proteins | ||
ZNHIT3-2327H | Recombinant Human ZNHIT3, His-tagged | +Inquiry |
KLC4-8672M | Recombinant Mouse KLC4 Protein | +Inquiry |
RFL13174RF | Recombinant Full Length Rat Nadh-Ubiquinone Oxidoreductase Chain 3(Mtnd3) Protein, His-Tagged | +Inquiry |
fur-4363E | Recombinant E.Coli Ferric Uptake Regulator | +Inquiry |
RFL13851LF | Recombinant Full Length Leptosphaeria Maculans C-5 Sterol Desaturase(Erg3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
FGB-43D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEGR1-2031HCL | Recombinant Human NEGR1 cell lysate | +Inquiry |
YTHDF2-236HCL | Recombinant Human YTHDF2 293 Cell Lysate | +Inquiry |
WBSCR22-362HCL | Recombinant Human WBSCR22 293 Cell Lysate | +Inquiry |
CCNH-7705HCL | Recombinant Human CCNH 293 Cell Lysate | +Inquiry |
DHRS3-6937HCL | Recombinant Human DHRS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PME21 Products
Required fields are marked with *
My Review for All PME21 Products
Required fields are marked with *
0
Inquiry Basket