Recombinant Full Length Nicotiana Tabacum Atp Synthase Subunit A(Atp6) Protein, His-Tagged
Cat.No. : | RFL20256NF |
Product Overview : | Recombinant Full Length Nicotiana tabacum ATP synthase subunit a(ATP6) Protein (P05499) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nicotiana tabacum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MFRRIFLFDEDSLNSSVTSYTNASQSTTTIMDYSLKSSDTQGSSSGIFTDHPGLNPCSER IVELQYDIRLKLGALMPKESAQKVLEASEALHGESNNIAFLEYLLEDLQQNGVGGEAYKD AVDLSKDLVSSPLEQFEIISLIPMKIGNLYFSFTNPSLFMLLTLSLVLLLVYFVTKKGGG NSVPNAWQSLVELIYDFVLNPVNEQIGGLSGNVKQKFSPRISVTFTFSLFCNPQGMIPYS FTVTSHFLITLGLSFSIFIGITIVGFQKNGLHFLSFLLPAGVPLPLAPFLVLLELIPYCF RALSSGIRLFANMMAGHSSVKILSGFAWTMLCMNDLLYFIGDLGPLFIVLALTGLELGVA ISQAHVSTILICIYLNDAINLHQSASFFIIEQKRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6 |
Synonyms | ATP6; ATP synthase subunit a; F-ATPase protein 6 |
UniProt ID | P05499 |
◆ Recombinant Proteins | ||
PXDNL-3154H | Recombinant Human PXDNL Protein, MYC/DDK-tagged | +Inquiry |
IFNL1-945H | Active Recombinant Human IFNL1 Protein | +Inquiry |
FAM174A-1589R | Recombinant Rhesus monkey FAM174A Protein, His-tagged | +Inquiry |
RFL2780GF | Recombinant Full Length Geobacter Metallireducens Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
ALG1-1540M | Recombinant Mouse ALG1 Protein | +Inquiry |
◆ Native Proteins | ||
PLE-105P | Active Native Porcine Esterase | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Diaphragm-137H | Human Fetal Diaphragm Membrane Lysate | +Inquiry |
RAB8A-2580HCL | Recombinant Human RAB8A 293 Cell Lysate | +Inquiry |
EIF2AK1-538HCL | Recombinant Human EIF2AK1 cell lysate | +Inquiry |
HA-2325HCL | Recombinant H16N3 HA cell lysate | +Inquiry |
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6 Products
Required fields are marked with *
My Review for All ATP6 Products
Required fields are marked with *
0
Inquiry Basket