Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL9552NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (Q9Q2W5) (1-577aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-577) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLIFRIAILLLTVVTLATSVASLVYSMGASTPSDLVGIP TRISRAEEKITSALGSNQDVVDRIYKQVALESPLALLNTETTIMNAITSLSYQINGAANN SGWGAPIHDPDFIGGIGKELIVDNASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDHSHSHQYLALGVLRTTATGRIFFSTLRSISLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSAVPTLMAHGRLGFDGQYHEKDLDVTTLFEDWVANYP GVGGGSFIDGRVWFSVYGGLKPNSPSDTVQEGKYVIYKRYNDTCPDEQDYQIRMAKSSYK PGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSY FSPALLYPMTVSNKTATLHSPYTFNAFTRPGSIPCQASARCPNSCVTGVYTDPYPLIFYR NHTLRGVFGTMLDSEQARLNPASAVFDSTSRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKNDGVREARSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | Q9Q2W5 |
◆ Recombinant Proteins | ||
NRXN1-4232C | Recombinant Chicken NRXN1 | +Inquiry |
STAT5B-6366H | Recombinant Human STAT5B Protein (Met1-Thr321), C-His tagged | +Inquiry |
GHR-1505R | Active Recombinant Rhesus macaque GHR protein, Fc-tagged | +Inquiry |
SIRB-2881B | Recombinant Bacillus subtilis SIRB protein, His-tagged | +Inquiry |
RFL18985AF | Recombinant Full Length Arabidopsis Thaliana Ethylene Receptor 1(Etr1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGA-30B | Native Bovine Fibrinogen | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM70B-6357HCL | Recombinant Human FAM70B 293 Cell Lysate | +Inquiry |
HLA-DRB3-798HCL | Recombinant Human HLA-DRB3 cell lysate | +Inquiry |
CYTH4-7093HCL | Recombinant Human CYTH4 293 Cell Lysate | +Inquiry |
ANAPC10-8871HCL | Recombinant Human ANAPC10 293 Cell Lysate | +Inquiry |
QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket