Recombinant Full Length Neurospora Crassa Probable Intron-Encoded Endonuclease 2(Ncu16009) Protein, His-Tagged
Cat.No. : | RFL23633NF |
Product Overview : | Recombinant Full Length Neurospora crassa Probable intron-encoded endonuclease 2(NCU16009) Protein (Q35134) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neurospora Crassa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MNITLILFLIGILGFVLNRKNIILMLISIEIMLLAITFLILVSSLNMDDIIGQTYAIYII VVAGAESAIGLAILVAFYRLINSPVKNPRSNYSGDPAPPSGGRGPYLHFNLLPVVSSCNL IQSRNYSSVLHRKIPTHTSCVWAGLNPSFITGFSDAEGSFVVTILKNPRYKIGWNVQARF QIKLNEKDRALLLLIQNYFDNIGYISKINDRSTVEFRVSDITSLNNIIIPHFEKYQLITN KYGDLVIFKQIVSLMLENKHTTLEGLKEILEHRASLNWGLSKTLKESFPSIIPVKRVKIE NNILSNLSSLPLLPGGGNWVAGFSSGEANFFITMSGTKVWLRFSIAQDSRDILLLKSLVK FFNCGYIAQYKNRKVCEFIVTKINDIIIYIIPFFDQYKIEGSKYNDYVKFKEAAILIKNK EHLTEKGLNKIIELKNSLPPPASLEGGMNKNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NCU16009 |
Synonyms | NCU16009; Probable intron-encoded endonuclease 2 |
UniProt ID | Q35134 |
◆ Recombinant Proteins | ||
S-066S | Recombinant SARS-CoV-2 Spike RBD (P521R) Mutant Protein, His-tagged | +Inquiry |
FAM78A-1452R | Recombinant Rhesus Macaque FAM78A Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKX-1963H | Recombinant Human PRKX, GST-tagged | +Inquiry |
TM9SF1-4744R | Recombinant Rhesus monkey TM9SF1 Protein, His-tagged | +Inquiry |
CD300c-73H | Recombinant Human CD300c protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
CST3-4309H | Native Human CST3 Protein | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Complement C1-42H | Native Human Complement C1 | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
C5b6-1537H | Active Native Human C5b,6 Complex Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
A4GALT-9163HCL | Recombinant Human A4GALT 293 Cell Lysate | +Inquiry |
SPRYD4-1488HCL | Recombinant Human SPRYD4 293 Cell Lysate | +Inquiry |
S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
KCNG4-5061HCL | Recombinant Human KCNG4 293 Cell Lysate | +Inquiry |
FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCU16009 Products
Required fields are marked with *
My Review for All NCU16009 Products
Required fields are marked with *
0
Inquiry Basket