Recombinant Full Length Neurospora Crassa Cytochrome B Mrna Maturase Bi3(Bi3) Protein, His-Tagged
Cat.No. : | RFL27878NF |
Product Overview : | Recombinant Full Length Neurospora crassa Cytochrome b mRNA maturase bI3(bI3) Protein (P0CY43) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neurospora Crassa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MRLLKSHPLLKLVNSYLIDASQPSNISYLWNFGSLLACCLIIQIVTGVTLAMHYSPNVLE AFNSIEHIMRDVNNGWLVRYLHSNTASAFFFLVYLHIGRGMYYGSYRAPRTLVWAIGTVI LILMMATAFLGYVLPYGQMSLWGATVITNLISAIPWIGQDIVESKIITLIINLSFIAILF SIVVVYYYILLHVNFSSNLPTIGVIHQNALKKSNKALRLDKQEYISIPSSFLAFLAGLVD GDGYIQVTKTSKGFIAIKLVISLHLEDLSILEYIHSVLKIGKINIYKDLRSPTCKLVINK TDLQEILFPLLMYNKIFFLTNTRADQFNLAMYIFKNDIKMYNQIPDNTPAVFEIPKNPID YTLLPFFKNWIVGFTCSEGSFFIKSNNDGCFQLKQRIHTNLFEAFKLMFNTNRKIDTTNN FNQFGVSSKSDIQKVINFFSFSGLHPLVGLKYIQYIKWLNNLRESLRYSTLNYPDAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bI3 |
Synonyms | bI3; cobi3; NCU16015; Cytochrome b mRNA maturase bI3 |
UniProt ID | P0CY43 |
◆ Recombinant Proteins | ||
murC-5789S | Recombinant Salmonella schwarzengrund murC Protein (Full Length), C-His tagged | +Inquiry |
ZNF32-5321R | Recombinant Rhesus monkey ZNF32 Protein, His-tagged | +Inquiry |
GAK-1336HFL | Recombinant Full Length Human GAK Protein, C-Flag-tagged | +Inquiry |
REXO1-5048H | Recombinant Human REXO1, His-tagged | +Inquiry |
GAN-6202M | Recombinant Mouse GAN Protein | +Inquiry |
◆ Native Proteins | ||
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
CLU-19H | Native Human Clusterin Protein | +Inquiry |
F5-284B | Active Native Bovine Factor V | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
PPIG-1396HCL | Recombinant Human PPIG cell lysate | +Inquiry |
TUBGCP3-641HCL | Recombinant Human TUBGCP3 293 Cell Lysate | +Inquiry |
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
HeLa-025HCL | Human Etoposide Stimulated HeLa Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bI3 Products
Required fields are marked with *
My Review for All bI3 Products
Required fields are marked with *
0
Inquiry Basket