Recombinant Full Length Debaryomyces Hansenii Cytochrome B Mrna Maturase Bi3(Bi3) Protein, His-Tagged
Cat.No. : | RFL29321DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii Cytochrome b mRNA maturase bI3(bI3) Protein (A9RAG7) (1-522aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-522) |
Form : | Lyophilized powder |
AA Sequence : | MTIRKSNPYLSLVNSYLMDSPQPSSMNYWWNVGSLLGLCLVMQMASGMFLAMHYSSSMEL AFNSVEHMMRDVNAGWLMRYIHANGASFFFMCLYLHMGKALYYGSYKSPRVLVWSMGVMM FMLTMATAFMGYCLVYGQMSHWGATVITNLLSAMPFMGGDLVPLSIILSLYLLYISLKTF MKMIFNQSYMCPAKGWVKKVLDNTFCIKKYMHMYLSSRTSPXLYINTMSNMQHMKIMSTK SHTKDRDTSFLEKDIKNMDRNLLALMVGFMDGDGYIRMNKKSKDNMNYIYMSLIMNLNKN DLKLLQYFHQQLNMGKVYNMTPKKGNKLARWEMNKLDLFNKMEPLLEYHNMKFLTETRQK QYLLLKYIKHNKLVYYEDIINNNNYINEFIENNTLMDNFIKLDYFNNWLVGFTMAEGSFL IKKNKDICFQLKQKYNLELFNNMTLFFNTTRKLNINKNKYMQFNVSSKNDIQNMINFFSF SNNQPLLGNKLISYNKWLFTIKNSMRYKELKTPYMSWHQKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bI3 |
Synonyms | bI3; Cytochrome b mRNA maturase bI3 |
UniProt ID | A9RAG7 |
◆ Native Proteins | ||
Lectin-1814P | Active Native Peanut Lectin Protein, Cy3 labeled | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
PLG -62R | Native Rabbit plasmin | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf114-8001HCL | Recombinant Human C6orf114 293 Cell Lysate | +Inquiry |
LZIC-4576HCL | Recombinant Human LZIC 293 Cell Lysate | +Inquiry |
Atrium-224H | Human Heart: Atrium (LT) Membrane Lysate | +Inquiry |
RFPL3-2404HCL | Recombinant Human RFPL3 293 Cell Lysate | +Inquiry |
FAM19A3-6387HCL | Recombinant Human FAM19A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bI3 Products
Required fields are marked with *
My Review for All bI3 Products
Required fields are marked with *
0
Inquiry Basket