Recombinant Full Length Neurospora Crassa Alpha-1,3/1,6-Mannosyltransferase Alg-2(Alg-2) Protein, His-Tagged
Cat.No. : | RFL22402NF |
Product Overview : | Recombinant Full Length Neurospora crassa Alpha-1,3/1,6-mannosyltransferase alg-2(alg-2) Protein (Q8X0H8) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neurospora Crassa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MAAGVDEKDKKTIVFLHPDLGIGGAERLVVDAAVGLQNRGHKVVIFTSHCDPRHCFDEAR DGTLDVRVRGNSIIPPSLLGRFSILCAILRQLHLILQITLLTSELRTLSPSAFFVDQLSA GLPLLKLLVPTSPIFFYCHFPDLLLVQGRQTWYKRLYRLPFDTWEEWSMGFADSIAVNSS FTKGIVSHTWPSLASKRSLEVVHPCIDVRSTSDSSQNPNDDDKDVLPWTKTGIILSINRF ERKKDIALAIKAFASLSPEQRGKAKLIIAGGYDNRVHENVSYHMDLVDLAEGAPYHLKTA TAKTVVSALNTSPDVEVLFLLSVPNTLKEILLRSAKLLVYTPSNEHFGIVPLEAMLRGVP VLAANNGGPTETVVEGETGWLRDPNDVGEWAKVMDKVLNGMGEEELKRMGKKGVERVKGR FADTQMAERLEEIIERMPKGDAAQSGMILLVVGAAVAAVAGVISAVYWKLW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alg-2 |
Synonyms | alg-2; B12N19.090; NCU03503; Alpha-1,3/1,6-mannosyltransferase alg-2; Asparagine-linked glycosylation protein 2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcNAc(2-PP-Do |
UniProt ID | Q8X0H8 |
◆ Recombinant Proteins | ||
STAT1-8473H | Active Recombinant Human STAT1, His-tagged | +Inquiry |
STRN-3021H | Recombinant Human STRN, His-tagged | +Inquiry |
CISD1-881R | Recombinant Rhesus monkey CISD1 Protein, His-tagged | +Inquiry |
TBRG1-417H | Recombinant Human TBRG1 Protein, MYC/DDK-tagged | +Inquiry |
PEF1-1645H | Recombinant Human PEF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACNG1-269HCL | Recombinant Human CACNG1 cell lysate | +Inquiry |
POLE-1390HCL | Recombinant Human POLE cell lysate | +Inquiry |
RNF146-2292HCL | Recombinant Human RNF146 293 Cell Lysate | +Inquiry |
ST8SIA3-1432HCL | Recombinant Human ST8SIA3 293 Cell Lysate | +Inquiry |
DGKA-6960HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All alg-2 Products
Required fields are marked with *
My Review for All alg-2 Products
Required fields are marked with *
0
Inquiry Basket