Recombinant Full Length Debaryomyces Hansenii Palmitoyltransferase Pfa3(Pfa3) Protein, His-Tagged
Cat.No. : | RFL1469DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii Palmitoyltransferase PFA3(PFA3) Protein (Q6BMV2) (1-405aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-405) |
Form : | Lyophilized powder |
AA Sequence : | MLISHPRIMIRHAPWVTSIETFCCSLATLFPKVFYTSVLTWSVYALIVHGCYDTLMTTQE TSIFAIAIGLIGLTLYILCLYTYFKVLRAGPGSPSDFEELRIRNILSLSKPKYNSANPYD TNDNMATSASLLANAEGVDEIESIESEQPPSEYMTLHMLKSNNSSYRYCTKCSVWKPDRC HHCSTCNRCVLRMDHHCPWFAMCVGFYNHKFFAQFLMYLTAYSGFDFVVSLSILWKFFAD EKYNDHYLSLNLVFLFVLSLAFFITVGGFSAFSLYLVFRNKTTIEFQENRWNFKNDKNGK SFQYEFDGSGKKKKLGNIFDLGCGRNWRSIMGPSWYYWLLPVTVTNKSIDARLENGINFE IDQDVYDRWCYNAQLQDQLNQQLADYKNRIRMEREANQTTDTNPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA3 |
Synonyms | PFA3; DEHA2F02398g; Palmitoyltransferase PFA3; Protein fatty acyltransferase 3 |
UniProt ID | Q6BMV2 |
◆ Recombinant Proteins | ||
FLT1-81H | Recombinant Human Fms-related Tyrosine Kinase 1, 5 Domains, Fc-tagged | +Inquiry |
ORF7a-93V | Recombinant 2019-nCoV ORF7a protein | +Inquiry |
FCGR3A-4109H | Recombinant Human FCGR3A Protein (Met1-Gln208), C-His tagged | +Inquiry |
CPSF4-1010R | Recombinant Rhesus monkey CPSF4 Protein, His-tagged | +Inquiry |
ADARB2-9743H | Recombinant Human ADARB2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL18-368HCL | Recombinant Human KLHL18 lysate | +Inquiry |
NMBR-3794HCL | Recombinant Human NMBR 293 Cell Lysate | +Inquiry |
MCPH1-4412HCL | Recombinant Human MCPH1 293 Cell Lysate | +Inquiry |
KCNK1-5041HCL | Recombinant Human KCNK1 293 Cell Lysate | +Inquiry |
PLEKHB2-3114HCL | Recombinant Human PLEKHB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PFA3 Products
Required fields are marked with *
My Review for All PFA3 Products
Required fields are marked with *
0
Inquiry Basket