Recombinant Full Length Neosartorya Fumigata Mitochondrial Import Inner Membrane Translocase Subunit Tim54(Tim54) Protein, His-Tagged
Cat.No. : | RFL26079NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Mitochondrial import inner membrane translocase subunit tim54(tim54) Protein (Q4WQ82) (1-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-439) |
Form : | Lyophilized powder |
AA Sequence : | MIFFTITGSLTAAIVYDRRERRRVQQKWCDLVAHLSKETLPIEQTRRKLTIFLSAPPGDG LRIAREHFKEYVKPILVAAALDYTVIEGRREGDVRAALAERIRKHRRKAGEPSSVVEEMS NEDIIADARQKIGVVEEPGPKGDLVIGRHTWKEYIRGLHEGWLGPLDPPSPPDAPVKGPS VPVEGSETPADGTPAEENTEKKEEAEKKDDKPAKPSGPTPAYVSPAEYSSRSLPPTLPQS LDSSVPIPFPHLLGFLNTPIRLYRYLSRRHLADEIGREVAGLVLASSSRPYHDGSFSSDS ELSGAMVDAGASTLSSPDDMMPSSSAKYEQQTVLEKEESEWHKSVHKRDEENPDKEREWI DDIVLDPRIASRMQRSLLSADEEARSQRITEGKEYILGEERPAPVSFWQRMWIKYGYGED EETIRMKPIIGNLDGADGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tim54 |
Synonyms | tim54; AFUA_4G11900; Mitochondrial import inner membrane translocase subunit tim54 |
UniProt ID | Q4WQ82 |
◆ Recombinant Proteins | ||
PSMA1-2652S | Recombinant Staphylococcus Aureus PSMA1 Protein (1-21 aa), His-sumostar-tagged | +Inquiry |
TCN1-569H | Recombinant Human TCN1 Protein, His-tagged | +Inquiry |
S4-7432R | Recombinant Reovirus type 3 S4 protein, His-tagged | +Inquiry |
CD70-375HFL | Active Recombinant Full Length Human CD70 Protein, C-Flag-tagged | +Inquiry |
TRIM35-21-4056Z | Recombinant Zebrafish TRIM35-21 | +Inquiry |
◆ Native Proteins | ||
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
HSV-1ag-265V | Active Native HSV-1 Protein | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
IgG-342R | Native RABBIT IgG | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOK3-506HCL | Recombinant Human DOK3 cell lysate | +Inquiry |
GUSB-5673HCL | Recombinant Human GUSB 293 Cell Lysate | +Inquiry |
EML2-247HCL | Recombinant Human EML2 lysate | +Inquiry |
RPL6-2190HCL | Recombinant Human RPL6 293 Cell Lysate | +Inquiry |
ERRFI1-6542HCL | Recombinant Human ERRFI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tim54 Products
Required fields are marked with *
My Review for All tim54 Products
Required fields are marked with *
0
Inquiry Basket