Recombinant Full Length Nematostella Vectensis Adenosine Monophosphate-Protein Transferase Ficd Homolog (V1G194069) Protein, His-Tagged
Cat.No. : | RFL2610NF |
Product Overview : | Recombinant Full Length Nematostella vectensis Adenosine monophosphate-protein transferase FICD homolog (v1g194069) Protein (A7SVT1) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nematostella vectensis (Starlet sea anemone) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MDSTQIKQGNLRYLIHLLLASLAGLSIAIIVTHAPVFWRLRSSKNTLDPPGFREGLNMLI PEIHFDAEVQDPLYGEALAALKAASAMKHGGKHSKAVKLFQQAVSLAPHHPEILLQYGEF LEQHDVVQAEHLYNRALTANPLDSRALANRQRALPKVKQLDQEMLDKIDEKRDKLFSIPA GSLPMKRAIKEAYFQHIYHSNAIEGNTMTLSMTRAIVETKMAVPGKSILEHNEVLGLDEA LKYVNSTLIQKSESITIDDIIEIHRRVLGHAHPLEAGRYRSTQVFVSDHVPPAPEDLEKQ MNAFNDWLLSKDPEILHPIEFAALSHYKLVYIHPFTDGNGRTARLLMNAILMRAGFPPVI IRFQDRHDYYEYLNQANHGDIRPFIRFVARCTERTIDAYLASTTIYPLGHERTRELTDAH DEKDPNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | v1g194069 |
Synonyms | v1g194069; Protein adenylyltransferase Fic; De-AMPylase Fic |
UniProt ID | A7SVT1 |
◆ Recombinant Proteins | ||
HA-421H | Recombinant H1N1 (A/USSR/90/1977) HA Protein, His-tagged | +Inquiry |
ANXA2-4987H | Recombinant Human ANXA2 protein(2-339aa), His-Myc-tagged | +Inquiry |
ST3GAL5-1072C | Recombinant Chicken ST3GAL5 | +Inquiry |
MYCN-3500R | Recombinant Rat MYCN Protein, His (Fc)-Avi-tagged | +Inquiry |
ADRB2B-5578Z | Recombinant Zebrafish ADRB2B | +Inquiry |
◆ Native Proteins | ||
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SS18-1468HCL | Recombinant Human SS18 293 Cell Lysate | +Inquiry |
SIRT4-1831HCL | Recombinant Human SIRT4 293 Cell Lysate | +Inquiry |
KIR2DL1-1701HCL | Recombinant Human KIR2DL1 cell lysate | +Inquiry |
L1210-168H | L1210 Whole Cell Lysate | +Inquiry |
ANKZF1-84HCL | Recombinant Human ANKZF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All v1g194069 Products
Required fields are marked with *
My Review for All v1g194069 Products
Required fields are marked with *
0
Inquiry Basket