Recombinant Full Length Neisseria Meningitidis Serogroup C Upf0756 Membrane Protein Nmcc_1816 (Nmcc_1816) Protein, His-Tagged
Cat.No. : | RFL18148NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup C UPF0756 membrane protein NMCC_1816 (NMCC_1816) Protein (A9M2Z3) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria meningitidis serogroup C |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MNVSFAPLFLVTLILLGVVSNNNSITISATILLLMQQTALIQFVPLVEKHGLNLGIILLT IGVLSPLVSGKAQVPPVAEFLNFKMISAVFIGIFVAWLAGRGVPLMGQQPVLITGLLIGT VIGVAFMGGIPVGPLIAAGILSFVVGKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMCC_1816 |
Synonyms | NMCC_1816; UPF0756 membrane protein NMCC_1816 |
UniProt ID | A9M2Z3 |
◆ Recombinant Proteins | ||
APOC4-224H | Recombinant Human APOC4 Protein, His-tagged | +Inquiry |
ZFP598-18996M | Recombinant Mouse ZFP598 Protein | +Inquiry |
KITLG-235H | Recombinant Human KITLG Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
RFL10414YF | Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb 1(Macb1) Protein, His-Tagged | +Inquiry |
ASB2-777M | Recombinant Mouse ASB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
SERPINA3-27285TH | Native Human SERPINA3 | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS3-6937HCL | Recombinant Human DHRS3 293 Cell Lysate | +Inquiry |
PRKX-2845HCL | Recombinant Human PRKX 293 Cell Lysate | +Inquiry |
RAB39A-1453HCL | Recombinant Human RAB39A cell lysate | +Inquiry |
INPP5F-863HCL | Recombinant Human INPP5F cell lysate | +Inquiry |
CLDN9-7457HCL | Recombinant Human CLDN9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMCC_1816 Products
Required fields are marked with *
My Review for All NMCC_1816 Products
Required fields are marked with *
0
Inquiry Basket