Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb 1(Macb1) Protein, His-Tagged
Cat.No. : | RFL10414YF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB 1(macB1) Protein (Q7CHI2) (1-649aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia pestis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-649) |
Form : | Lyophilized powder |
AA Sequence : | MAALLELEGIRRSYQSGEEIVDVLQDVSLTINAGELVAIIGASGSGKSTLMNILGCLDKP SAGIYRVAGQNVDELDDDALAALRREHFGFIFQRYHLLPHLSAAHNVEVPAVYAGLGKHE RRERANMLLTRLGLGDRVSYQPNQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSS VEVMAILKQLQQQGHTVIIVTHDPTVAAQAERVIEIKDGRIMADSGSKNEPVVAAAELMS LTPAAPSWQQLVGRFREALLMAWRAMSANKMRTALTMLGIIIGIASVVSILVVGDAAKQL VLADIRAIGTNTIDIYPGKDFGDDDPSTRQALVHDDMAALKAQSYVSAVSPSIGGSMRLR FGNIDVAASVLGVSDEYFRVFGMAMEQGAPITREQVERQAQTVVIDLNTQRRLFPHMKDV VGQVILVGNMPATVVGVVAEKKSMFGSNKALRVWVPYSTMANRLMGRSYFDSITIRIKEG YSSKEAEQQLVRLLTLRHGKKDIFTYNMDSLLQTAEKTTQTMQLFLTLVAVISLVVGGIG VMNIMLVSVTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIGGALGISLSFAIGLIVE MFLPNWRIAFPPMALFSAFLCSTVIGVVFGYLPARSAARLNPIDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB1 |
Synonyms | macB1; YPO1365; y2813; YP_1229; Macrolide export ATP-binding/permease protein MacB 1 |
UniProt ID | Q7CHI2 |
◆ Recombinant Proteins | ||
Vegfc-5536R | Active Recombinant Rat Vegfc 152S Mutant Protein | +Inquiry |
Ddx47-2509M | Recombinant Mouse Ddx47 Protein, Myc/DDK-tagged | +Inquiry |
TNNT3B-9630Z | Recombinant Zebrafish TNNT3B | +Inquiry |
CRLF3-1032R | Recombinant Rhesus monkey CRLF3 Protein, His-tagged | +Inquiry |
TAAR8C-5899R | Recombinant Rat TAAR8C Protein | +Inquiry |
◆ Native Proteins | ||
LOC102577615-62P | Native potato LOC102577615 Protein | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK3-1832HCL | Recombinant Human KLK3 cell lysate | +Inquiry |
L3HYPDH-8284HCL | Recombinant Human C14orf149 293 Cell Lysate | +Inquiry |
ABHD5-9132HCL | Recombinant Human ABHD5 293 Cell Lysate | +Inquiry |
RNF126-2302HCL | Recombinant Human RNF126 293 Cell Lysate | +Inquiry |
Jurkat-256H | Human Jurkat Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB1 Products
Required fields are marked with *
My Review for All macB1 Products
Required fields are marked with *
0
Inquiry Basket