Recombinant Full Length Neisseria Meningitidis Serogroup A / Serotype 4A Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL31254NF |
Product Overview : | Recombinant Full Length Neisseria meningitidis serogroup A / serotype 4A Membrane protein insertase YidC(yidC) Protein (Q9JW48) (1-545aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria meningitidis serogroup A / serotype 4A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-545) |
Form : | Lyophilized powder |
AA Sequence : | MDFKRLTAFFAIALVIMIGWEKMFPTPKPVPAPQQTAQQQAVTASAEAALAPATPITVTT DTVQAVIDEKSGDLRRLTLLKYKATGDENKPFILFGDGKEYTYVAQSELLDAQGNNILKG IGFSAPKKQYSLEGDKVEVRLSAPETRGLKIDKVYTFTKGSYLVNVRFDIANGSGQTANL SADYRIVRDHSEPEGQGYFTHSYVGPVVYTPEGNFQKVSFSDLDDDAKSGKSEAEYIRKT PTGWLGMIEHHFMSTWILQPKGGQSVCAAGDCRIDIKRRNDKLYSTSVSVPLAAIQNGAK SEASINLYAGPQTTSVIANIADNLQLAKDYGKVHWFASPLFWLLNQLHNIIGNWGWAIIV LTIIVKAVLYPLTNASYRSMAKMRAAAPKLQAIKEKYGDDRMAQQQAMMQLYTDEKINPL GGCLPMLLQIPVFIGLYWALFASVELRQAPWLGWITDLSRADPYYILPIIMAATMFAQTY LNPPPTDPMQAKMMKIMPLVFSVMFFFFPAGLVLYWVINNLLTIAQQWHINRSIEKQRAQ GEVVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; NMA0548; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q9JW48 |
◆ Native Proteins | ||
Lectin-1719P | Native Peanut Lectin, FITC conjugated | +Inquiry |
TF-172S | Native Sheep transferrin | +Inquiry |
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD18-2561HCL | Recombinant Human RAD18 293 Cell Lysate | +Inquiry |
CYP1A1-7126HCL | Recombinant Human CYP1A1 293 Cell Lysate | +Inquiry |
KIAA1586-4961HCL | Recombinant Human KIAA1586 293 Cell Lysate | +Inquiry |
DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
OGFOD2-1245HCL | Recombinant Human OGFOD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket