Recombinant Full Length Neisseria Gonorrhoeae Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL11360NF |
Product Overview : | Recombinant Full Length Neisseria gonorrhoeae Membrane protein insertase YidC(yidC) Protein (B4RJJ2) (1-545aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neisseria gonorrhoeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-545) |
Form : | Lyophilized powder |
AA Sequence : | MDFKRLTAFFAIALVIMIGWEKMFPTPKPVPAPQQAAQKQAATASAEAALAPATPITVTT DTVQAVIDEKSGDLRRLTLLKYKATGDENKPFVLFGDGKEYTYVAQSELLDAQGNNILKG IGFSAPKKQYTLNGDTVEVRLSAPETNGLKIDKVYTFTKDSYLVNVRFDIANGSGQTANL SADYRIVRDHSEPEGQGYFTHSYVGPVVYTPEGNFQKVSFSDLDDDAKSGKSEAEYIRKT PTGWLGMIEHHFMSTWILQPKGGQSVCAAGDCHIDIKRRSDKLYSASVSVPLAAIQAGAK AETAVNLYAGPQTTSVIANIADNLQLAKDYGKVHWFASPLFWLLNQLHNIIGNWGWAIVV LTIIVKAVLYPLTNASYRSMAKMRAAAPKLQTIKEKYGDDRMAQQQAMMQLYKDEKINPL GGCLPMLLQIPVFIGLYWALFASVELRQAPWLGWITDLSRADPYYILPIIMAATMFAQTY LNPPPTDPMQAKMMKIMPLVFSVMFFFFPAGLVLYWVVNNLLTIAQQWHINRSIEKQRAQ GEVVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; NGK_2658; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B4RJJ2 |
◆ Recombinant Proteins | ||
SMARCB1-1013H | Recombinant Human SMARCB1 Protein (2-376 aa), His-SUMO-tagged | +Inquiry |
RFL13234OF | Recombinant Full Length Oreochromis Niloticus G-Protein Coupled Receptor 54(Gpr54) Protein, His-Tagged | +Inquiry |
IKZF2-2226R | Recombinant Rhesus monkey IKZF2 Protein, His-tagged | +Inquiry |
DNAJB4-467C | Recombinant Cynomolgus DNAJB4 Protein, His-tagged | +Inquiry |
AKT2-307H | Recombinant Human AKT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry |
PCSK9-2306RCL | Recombinant Rat PCSK9 cell lysate | +Inquiry |
RSPH4A-570HCL | Recombinant Human RSPH4A lysate | +Inquiry |
FOXR1-6143HCL | Recombinant Human FOXR1 293 Cell Lysate | +Inquiry |
Stomach-481P | Porcine Stomach Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket