Recombinant Full Length Nandina Domestica Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL24123NF |
Product Overview : | Recombinant Full Length Nandina domestica NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q09FQ5) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nandina domestica (Heavenly bamboo) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTKVQQAINSFSRSESLKEVYGLIWLLVPIFTPLLGIIIGVLVIVWLERQISAGVQ QRIGPEYAGPLGILQALADGTKLLFKEDLLPSRGDILLFSLGPSIAVISILLSYSVIPFG YHLVLADLSIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTPCV LSISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFMVFLISSLAECERLPFDLPEAEEE LVAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFIFIPELFRINEV CGIFGMTIGIFITLAKAYLFLFISITTRWTLPRMRMDQLLNLGWKFLLPISLGNLLLTTS FQLLSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q09FQ5 |
◆ Recombinant Proteins | ||
MRPL37-5580H | Recombinant Human MRPL37 Protein, GST-tagged | +Inquiry |
NCAM1-3264H | Recombinant Human NCAM1 protein, His-tagged | +Inquiry |
PEPD-30836TH | Recombinant Human PEPD | +Inquiry |
ZFP579-18988M | Recombinant Mouse ZFP579 Protein | +Inquiry |
LACE1-2998R | Recombinant Rat LACE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-27283TH | Native Human ORM1 | +Inquiry |
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
◆ Cell & Tissue Lysates | ||
Artery-23H | Human Artery Lupus Lysate | +Inquiry |
SNAPC5-1636HCL | Recombinant Human SNAPC5 293 Cell Lysate | +Inquiry |
NDFIP1-3935HCL | Recombinant Human NDFIP1 293 Cell Lysate | +Inquiry |
ODF3-3597HCL | Recombinant Human ODF3 293 Cell Lysate | +Inquiry |
HOP62-048WCY | Human Lung Adenocarcinoma HOP62 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket