Recombinant Full Length Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL10123LF |
Product Overview : | Recombinant Full Length NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q9BBN9) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lotus japonicus (Lotus corniculatus var. japonicus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTEVQDINSFSRLESFKEVYGVLWVLAPILIIVLGITISVLAIVWLEREISAGMQQ RIGPEYAGPFGVLQALADGTKLLFKENLIPSRGDIRLFSIGPSISVISILITYLVIPFSY NFVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSLSTVDIVDAQSKYGFWGWNLWRQPMGFVVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLISSLFVTVLYLGGSNISIPYISLFEFFEINKEYGV FGTTIGIFITLAKTYLFLFVSIITRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL FSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q9BBN9 |
◆ Native Proteins | ||
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
Phosphorylase B-49R | Active Native Rabbit Phosphorylase B | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM13C-259HCL | Recombinant Human FAM13C lysate | +Inquiry |
AFF4-8988HCL | Recombinant Human AFF4 293 Cell Lysate | +Inquiry |
Fetal Heart-143H | Human Fetal Heart Membrane Lysate | +Inquiry |
ARL13B-8721HCL | Recombinant Human ARL13B 293 Cell Lysate | +Inquiry |
HLA-DRB5-799HCL | Recombinant Human HLA-DRB5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket