Recombinant Full Length Mycoplasma Pneumoniae Uncharacterized Protein Mg241 Homolog (Mpn_337) Protein, His-Tagged
Cat.No. : | RFL29340MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Uncharacterized protein MG241 homolog (MPN_337) Protein (P75441) (1-621aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-621) |
Form : | Lyophilized powder |
AA Sequence : | MVKKELEMYNLYTFQIDLDKKLLFEKADNQQNYSKIRARYFKNSARNQQAVFLNKNLIKN TFNKALLNFSDFLSGSGVESIFKQVIDDQPEVLNYLKQVKKEDSCDGHSEASQLVFNVVI NPKNTLANFFEELTIYLHFNEENNTVVGSFSLKWNIKRADLFSETKNIAINNLIHTFCKN NLNEVSFIQIIKCFAKTLINKQGQIVLESCAFKQKWQNIVEQKYPFSTIHKNLKIVNSDF FDAFFVILLLICHLNNNLLWLCEKTEHFEWKLNSKISNFKEDNTEVYLSKMLLFLKDWYF ENQAVTNEDIEKVDEVEDIGKLVEKYSANQPQKLSSNSTVYVFEPDKKQCFLKNDDFFNT NEAKLLFLITMQPNVFGLDDTAIANDLNLREIGDFFKEIDFTDSDVLNDFQQQKETLLVR RTFNQLLFMNSNTDVLSIVNNKFKSAIHNIVWTITYSKAIMLKAFDYSKIFEQNRTNDPS LLRSNLNSINRLRYLSEYFRTASVKYDQLYTKVKEYMQLDQFLVDMINQVNHEDEIFGKY KERVYLSLGIVTAVVFGIIEFFNCVWTVLTVSQQTAEKSLADPRNTVIIGIGTILVLTLL ITILTFMTRRLYLFEFNKKHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_337 |
Synonyms | MPN_337; F10_orf621; MP499; Uncharacterized protein MG241 homolog |
UniProt ID | P75441 |
◆ Recombinant Proteins | ||
GINM1-6357M | Recombinant Mouse GINM1 Protein | +Inquiry |
PRPL-1139P | Recombinant Pseudomonas Aeruginosa PRPL Protein (212-462 aa), His-SUMO-tagged | +Inquiry |
MCAT-2698R | Recombinant Rhesus monkey MCAT Protein, His-tagged | +Inquiry |
MAGEA6-3200H | Recombinant Human MAGEA6 protein, His&Myc-tagged | +Inquiry |
FCABP-23C | Recombinant Chagas FCABP protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLF7-4925HCL | Recombinant Human KLF7 293 Cell Lysate | +Inquiry |
TSG101-719HCL | Recombinant Human TSG101 293 Cell Lysate | +Inquiry |
MATK-4450HCL | Recombinant Human MATK 293 Cell Lysate | +Inquiry |
RAD17-2563HCL | Recombinant Human RAD17 293 Cell Lysate | +Inquiry |
Bladder-81M | Mouse Bladder Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPN_337 Products
Required fields are marked with *
My Review for All MPN_337 Products
Required fields are marked with *
0
Inquiry Basket