Recombinant Full Length Mycoplasma Pneumoniae Putative Abc Transporter Atp-Binding Protein Mg015 Homolog (Mpn_019) Protein, His-Tagged
Cat.No. : | RFL25789MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Putative ABC transporter ATP-binding protein MG015 homolog (MPN_019) Protein (P75094) (1-634aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-634) |
Form : | Lyophilized powder |
AA Sequence : | MLSSCRAVTSMSRWSKHKKTKEVISMLSHNQKPNSWKILWRLIKSVQGRTSSKVLYVMVC AIFGILTGVTNSILLAQGLGFIFPTTNTETDGIQSVYLLVFAHNLPVMERLTIVCVTVVV AYILIFSFNVAQNYLGLKLYQEICALLRWKAYLKIQSMSTSFFDTQNNGDLMSRLTNDVY NINNLYAQVGGQTIQSLFILMTTATILFVLSPVIALISLTVLIALIALSFLFLKKARAAY AKVQNNLGDMSGYIEEVLSNHKVVHVLKLQEVMIDNFDKYNRPMVNPTIKANTYAVFIYS WFGFISNITYLASISIATAFSVNNIPSFGVSAINYSFMLSYIAALRQTALPLNQIFSLWN LIQLGIVSGERVFKILDLESPQKQATITKLPNIKGNIRFEKVVFGYSADKPILTGIDFSV KHGDIVAIVGPTGAGKSTIINLLMKFYKPFAGKIYMDNFEISEVSETAWREKISIVLQDP FLFSGTIKENIRMGRQDATDEEIIEACKVANAHDFIMRLPQGYNTFISNKTDYLSVGERQ LLTIARAVIRNAPVLLLDEATSSIDVHSEKLIQQSIGRLMKDKTSFIISHRLSIIRNATL IIVINDGKVLEMGNHEQLMRQNGFYARLKRSAVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPN_019 |
Synonyms | MPN_019; D12_orf634; MP135; Putative ABC transporter ATP-binding protein MG015 homolog |
UniProt ID | P75094 |
◆ Recombinant Proteins | ||
GLI2-3595M | Recombinant Mouse GLI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
REP15-7525M | Recombinant Mouse REP15 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNG-5645H | Recombinant Human CHRNG protein, His-tagged | +Inquiry |
MSLN-10623H | Recombinant Human MSLN protein, His-tagged, Biotin Labeled. | +Inquiry |
gB-1999H | Recombinant HHV-2 gB Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPIRE2-1506HCL | Recombinant Human SPIRE2 293 Cell Lysate | +Inquiry |
KIF3B-931HCL | Recombinant Human KIF3B cell lysate | +Inquiry |
FTMT-6125HCL | Recombinant Human FTMT 293 Cell Lysate | +Inquiry |
CPNE1-001HCL | Recombinant Human CPNE1 cell lysate | +Inquiry |
MDH1B-4408HCL | Recombinant Human MDH1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPN_019 Products
Required fields are marked with *
My Review for All MPN_019 Products
Required fields are marked with *
0
Inquiry Basket