Recombinant Full Length Mycoplasma Pneumoniae Oligopeptide Transport System Permease Protein Oppc(Oppc) Protein, His-Tagged
Cat.No. : | RFL33561MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Oligopeptide transport system permease protein oppC(oppC) Protein (P75553) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MDKHQKFDQSLFQRVDINVLKRSDQLIGKPTTNFVEIMKRLFQNKWAILFFLLIVLIILL AIIVPLASPYSAVTPVSNNALAQNLPPRYLWNGAGDIQVEKITARSIAEVAQSSGVLVGK LPEASSNPLATNVKYNIAPYQLAELKNYYPLLGTNGLGVDIWTLLWASMAKSLWIAIVVA LVSMVFGTIYGAIAGSFVGRAADNIMSRIIEIIDLVPSILWIIVLGATFRFGGVKQFDDS VVIFTLIFVFWTWPAATTRIYILKNKDTEYIQAARTLGAKQIRIIFVHMLPVVTGRLAVV FVSLIPAVIGYEASLVFLGLKPATEVGLGALLNQVTSSGNIALITSSIVSFAILTVSTRV FANALNDAIDPRVIRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | oppC |
Synonyms | oppC; MPN_216; MP615; Oligopeptide transport system permease protein OppC |
UniProt ID | P75553 |
◆ Recombinant Proteins | ||
CREG2-2291HF | Recombinant Full Length Human CREG2 Protein, GST-tagged | +Inquiry |
CNP1-4120C | Recombinant Chicken CNP1 | +Inquiry |
SOX-2-9491Z | Recombinant Zebrafish SOX-2 | +Inquiry |
EPCAM-81HAF555 | Recombinant Human EPCAM Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
MSLN-381H | Recombinant Human MSLN Protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
AC-63B | Native Bovine Activated Protein C | +Inquiry |
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
PLG-27925TH | Native Human PLG | +Inquiry |
pla2-839S | Active Native Snake Phospholipase A2 protein | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
TMOD2-916HCL | Recombinant Human TMOD2 293 Cell Lysate | +Inquiry |
CCNK-306HCL | Recombinant Full Length Human CCNK cell lysate | +Inquiry |
VAT1L-424HCL | Recombinant Human VAT1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All oppC Products
Required fields are marked with *
My Review for All oppC Products
Required fields are marked with *
0
Inquiry Basket