Recombinant Full Length Mycoplasma Genitalium Oligopeptide Transport System Permease Protein Oppc(Oppc) Protein, His-Tagged
Cat.No. : | RFL5016MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Oligopeptide transport system permease protein oppC(oppC) Protein (P47324) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MDRNKSFDPNLFKRVDINLLKRNDQLIGKPTTNSIEIIKRLFQNKWAILFFLLIVVIVLL AIIVPLTSPFSAVTPVSTNALAQNLPPRYLWHKPGDILVHKITARSIAEISQASGVLVGT LPSANSNPLATNVQYDIAPFQLQELRNYFPLLGTNGLGIDIWTLLWASVAKSLWIAVVVA IIAMVFGTIYGAVAGSFVGHMADNIMSRIIEIIDIVPSILWIIVLGATFRFGGVKQFDDS VVIFTLIFVFWTWPATTTRIYILKNKDTEYIQAAKTLGAHQIRIIFVHMLPVVFGRLAVV FVSLIPAVIGYEASLVFLGLKPATDIGLGALLNQVTSSDNVALILSSIVSFAVLTVAART FANALNDAIDPRVVKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | oppC |
Synonyms | oppC; MG078; Oligopeptide transport system permease protein OppC |
UniProt ID | P47324 |
◆ Recombinant Proteins | ||
ANGPTL2-1151HF | Recombinant Full Length Human ANGPTL2 Protein, GST-tagged | +Inquiry |
Grb14-1736M | Recombinant Mouse Grb14 protein, His & T7-tagged | +Inquiry |
IMPDH2-4535M | Recombinant Mouse IMPDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDR-9741Z | Recombinant Zebrafish HDR | +Inquiry |
BTK-530H | Recombinant Human BTK, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-01H | Native Human Troponin Protein | +Inquiry |
UMOD-91P | Native Porcine UMOD | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
Fxa-281B | Active Native Bovine Factor Xa | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB2-130HCL | Recombinant Human ARRB2 cell lysate | +Inquiry |
PHF16-3234HCL | Recombinant Human PHF16 293 Cell Lysate | +Inquiry |
MED9-4377HCL | Recombinant Human MED9 293 Cell Lysate | +Inquiry |
B3GALTL-1103HCL | Recombinant Human B3GALTL cell lysate | +Inquiry |
TRMT1L-224HCL | Recombinant Human TRMT1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All oppC Products
Required fields are marked with *
My Review for All oppC Products
Required fields are marked with *
0
Inquiry Basket