Recombinant Full Length Mycoplasma Genitalium Uncharacterized Protein Mg443 (Mg443) Protein, His-Tagged
Cat.No. : | RFL26797MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Uncharacterized protein MG443 (MG443) Protein (P47681) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MKFFNNLFKKESKITVASGSKRVRISNSFLMFSNLYEAKKPLKYVLVYLLSIINAFLLLI FIQKTGLYSFGISSLTQGFARLVFVLLKSFDETQRLLIFNILYWLLYVFINIPLIIFSYK KIGKNFTILSTHFVVASNVFGFLISIIPGSDNLPPMLASITDTNFWKAAKDLNQSAGFVP FLWSDTSQGNVIISTFIYAAIYGFYNGISVSLLYILGGSAGGADFLTQYYARKKNRSVGS ILFYVNSFILIIAILIGSFVAGSLLLQDVNNYRDSAWEVSLFFSPNLIATFFSILLTGTV VSYLFPRYNFAEIKVFTDKLEEVRKALLSDNANHSLSIQETLGGYSLLKKKMIVSVSMYV EIPHLIKIIRQIDKDCLVSITRIRGIDGHIYLRQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MG443 |
Synonyms | MG443; Uncharacterized protein MG443 |
UniProt ID | P47681 |
◆ Recombinant Proteins | ||
EFNB3B-9317Z | Recombinant Zebrafish EFNB3B | +Inquiry |
SEPT11-652C | Recombinant Cynomolgus Monkey SEPT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF4-659H | Active Recombinant Human TNFRSF4, Fc-tagged, Biotinylated | +Inquiry |
RFL29082SF | Recombinant Full Length Protein Crcb Homolog 3(Crcb3) Protein, His-Tagged | +Inquiry |
EPHB4-4762H | Recombinant Human EPH Receptor B4, His-tagged | +Inquiry |
◆ Native Proteins | ||
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
ALPL-25H | Active Native Human ALPL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PER1-1332HCL | Recombinant Human PER1 cell lysate | +Inquiry |
NFATC2IP-3857HCL | Recombinant Human NFATC2IP 293 Cell Lysate | +Inquiry |
PWP1-2656HCL | Recombinant Human PWP1 293 Cell Lysate | +Inquiry |
Fronal Lobe-24H | Human Frontal Lobe Tissue Lysate | +Inquiry |
ILK-5220HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MG443 Products
Required fields are marked with *
My Review for All MG443 Products
Required fields are marked with *
0
Inquiry Basket