Active Recombinant Human TNFRSF4, Fc-tagged, Biotinylated

• Cat.No.: TNFRSF4-659H
• Product Overview: The recombinant human OX40-Fc fusion is expressed as a 414 amino acid protein consisting of Leu29 - Ala214 region of OX40 (UniProt accession #P43489) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 29-214 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds to OX40 ligand and anti-OX40/CD134 monoclonal antibodies with high affinity by ELISA. Blocks OX40 Ligand-induced signaling activity.
• Molecular Mass: Calculated molecular mass (kDa): 45.5; Estimated by SDS-PAGE under reducing condition (kDa): ~65
• AA Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTAT QDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQP QETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
• Official Symbol: TNFRSF4
• Synonyms: TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor
• Gene ID: 7293
• mRNA Refseq: NM_003327
• Protein Refseq: NP_003318
• MIM: 600315
• UniProt ID: P43489
• Chromosome Location: 1p36
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem
• Function: binding; receptor activity; tumor necrosis factor-activated receptor activity