Active Recombinant Human TNFRSF4, Fc-tagged, Biotinylated
Cat.No. : | TNFRSF4-659H |
Product Overview : | The recombinant human OX40-Fc fusion is expressed as a 414 amino acid protein consisting of Leu29 - Ala214 region of OX40 (UniProt accession #P43489) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 29-214 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to OX40 ligand and anti-OX40/CD134 monoclonal antibodies with high affinity by ELISA. Blocks OX40 Ligand-induced signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 45.5; Estimated by SDS-PAGE under reducing condition (kDa): ~65 |
AA Sequence : | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTAT QDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQP QETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor; |
Gene ID | 7293 |
mRNA Refseq | NM_003327 |
Protein Refseq | NP_003318 |
MIM | 600315 |
UniProt ID | P43489 |
Chromosome Location | 1p36 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; |
Function | binding; receptor activity; tumor necrosis factor-activated receptor activity; |
◆ Recombinant Proteins | ||
Tnfrsf4-450R | Recombinant Rat Tnfrsf4 Protein, His-tagged | +Inquiry |
Tnfrsf4-7075M | Recombinant Mouse Tnfrsf4 protein, His-tagged | +Inquiry |
TNFRSF4-340M | Active Recombinant Marmoset TNFRSF4 protein, His-tagged | +Inquiry |
TNFRSF4-0592M | Active Recombinant Mouse TNFRSF4 protein, Fc-tagged | +Inquiry |
TNFRSF4-115R | Recombinant Rabbit TNFRSF4 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
0
Inquiry Basket