Recombinant Full Length Mycobacterium Avium (Dimethylallyl)Adenosine Trna Methylthiotransferase Miab Protein, His-Tagged
Cat.No. : | RFL8705MF |
Product Overview : | Recombinant Full Length Mycobacterium avium (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB Protein (A0QIR4) (1-715aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium avium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-715) |
Form : | Lyophilized powder |
AA Sequence : | MTCGFSRADRSPYHGPVTSTVARDVSGVRTYQVRTYGCQMNVHDSERLAGLLEAAGYRRA AEGAEVADVVVFNTCAVRENADNKLYGNLSHLAPRKRSNPQMQIAVGGCLAQKDREAVLR RAPWVDVVFGTHNIGSLPTLLERARHNKAAQVEIAEALQQFPSSLPSARESAYAAWVSIS VGCNNSCTFCIVPSLRGKEVDRSPDDILAEVRSLVADGVLEVTLLGQNVNAYGVSFADPA LPRDRGAFARLLRACGEIDGLERVRFTSPHPAEFTDDVIEAMAQTPNVCPALHMPLQSGS DRVLRAMRRSYRAERYLGIIDRVRAAMPHAAITTDLIVGFPGETEEDFAATLDVVRRARF AAAFTFQYSKRPGTPAAELDGQIPKAVVQERYERLVELQESISLQGNQALVGQTVELLVA TGEGRKDSATARMSGRARDGRLVHFAADDRVRPGDLVTTVITGAAPHHLIADAGILSHRR TRAGDAHAPAGARAASVSACPPSGRRRPGPTRWMCLMNDDRNHDDPRLGALRTEIEAAER RVAGGIDPGARGFVVSILVFVLLGSFILPHTGDVRGWDVLFGTHDAGAAAVALPSRVFGW LALVFGVGFSTLALVTRRWALAWIALAGTAIAGAAGMLAIWSRQTVPAGHPGPGWGLIVA WITVLVLIYQWARVVWSRTIVQLAAEEQRRRVAAQQQSTTLLDDLPKPEDPAAGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | miaB |
Synonyms | miaB; MAV_3625; tRNA-2-methylthio-N(6-dimethylallyladenosine synthase; (Dimethylallyladenosine tRNA methylthiotransferase MiaB; tRNA-i(6A37 methylthiotransferase |
UniProt ID | A0QIR4 |
◆ Recombinant Proteins | ||
LUZP2-4360C | Recombinant Chicken LUZP2 | +Inquiry |
SCFD1-3906R | Recombinant Rhesus Macaque SCFD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL12B-1608H | Active Recombinant Human IL12B protein, Fc-tagged | +Inquiry |
EMCN-2766M | Recombinant Mouse EMCN Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL33404YF | Recombinant Full Length Yarrowia Lipolytica Peroxisomal Biogenesis Factor 9(Pex9) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
FGA-34D | Native Canine Fibrinogen | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F6-521HCL | Recombinant Human E2F6 cell lysate | +Inquiry |
JAM2-2123MCL | Recombinant Mouse JAM2 cell lysate | +Inquiry |
FOXP1-6146HCL | Recombinant Human FOXP1 293 Cell Lysate | +Inquiry |
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
TLX3-1040HCL | Recombinant Human TLX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All miaB Products
Required fields are marked with *
My Review for All miaB Products
Required fields are marked with *
0
Inquiry Basket