Recombinant Full Length Yarrowia Lipolytica Peroxisomal Biogenesis Factor 9(Pex9) Protein, His-Tagged
Cat.No. : | RFL33404YF |
Product Overview : | Recombinant Full Length Yarrowia lipolytica Peroxisomal biogenesis factor 9(PEX9) Protein (P45817) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yarrowia lipolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MTMSARVRKMALPSNCDLSDVEMICDNVLGCLEDLDSSRVVSRVTSREDVDESTIGDLIS LDCVSLETPLFSFLFLGVTLFLFLSLLQQSLVFLLGVFLRLVQLVGHFLLLLMGEQIGVI DKAMSHIPLPEVGQHSQQVQIQHLVERRFGLDVVTAIVVIGDNELFQVVGHQFRVGIMSD GQRSQQSQNSGMNVASSSRGRHQLVPDRPGSQLSSQKLSSLVPLARIAAAEIPCAVQQSL SRLFARSVQNRQVQRPHLDPQRQRNIVGVFGVQHGRAVLLCALGGDLIEKRPNQLVRVVK VLVDKFPRRLPKRLVHLVHLGRGSLVHCRCDRVCQQRGCCHLWHCGGHFFVGLVSWIVDE TAACVVFCLFKVVSETQRISSLPRYMHRELNTAGVVWGCGGKHM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PEX9 |
Synonyms | PEX9; PAY2; YALI0F00748g; Peroxisomal biogenesis factor 9; Peroxin-9; Peroxisomal protein PAY2 |
UniProt ID | P45817 |
◆ Native Proteins | ||
C2-98H | Active Native Human C2 Protein | +Inquiry |
ALB-5363B | Native Bovine Albumin | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZC4H2-914HCL | Recombinant Human ZC4H2 cell lysate | +Inquiry |
TEKT5-1149HCL | Recombinant Human TEKT5 293 Cell Lysate | +Inquiry |
DDAH1-448HCL | Recombinant Human DDAH1 cell lysate | +Inquiry |
SPACA3-1678HCL | Recombinant Human SPACA3 cell lysate | +Inquiry |
SERPINA1-2856HCL | Recombinant Human SERPINA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX9 Products
Required fields are marked with *
My Review for All PEX9 Products
Required fields are marked with *
0
Inquiry Basket