Recombinant Full Length Mouse Transmembrane Protein 9B(Tmem9B) Protein, His-Tagged
Cat.No. : | RFL29160MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 9B(Tmem9b) Protein (Q9JJR8) (35-199aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (35-199) |
Form : | Lyophilized powder |
AA Sequence : | AKNFEDVRCKCICPPYKENPGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKY EERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHSQLLQSDDDVGDHQPFA NAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem9b |
Synonyms | Tmem9b; Transmembrane protein 9B |
UniProt ID | Q9JJR8 |
◆ Native Proteins | ||
IgG-336S | Native Sheep Gamma Globulin Fraction | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACO2-498HCL | Recombinant Human ACO2 cell lysate | +Inquiry |
TXNIP-620HCL | Recombinant Human TXNIP 293 Cell Lysate | +Inquiry |
GYPC-769HCL | Recombinant Human GYPC cell lysate | +Inquiry |
M6PR-398HCL | Recombinant Human M6PR lysate | +Inquiry |
CerebralCortex-424S | Sheep Cerebral Cortex Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem9b Products
Required fields are marked with *
My Review for All Tmem9b Products
Required fields are marked with *
0
Inquiry Basket