Recombinant Full Length Human TMEM9B Protein, GST-tagged
Cat.No. : | TMEM9B-1796HF |
Product Overview : | Human C11orf15 full-length ORF ( AAH40124, 34 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 198 amino acids |
Description : | Involved in positive regulation of I-kappaB kinase/NF-kappaB signaling. Predicted to be located in early endosome membrane and lysosomal membrane. Predicted to be integral component of membrane. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.89 kDa |
AA Sequence : | AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM9B TMEM9 domain family, member B [ Homo sapiens ] |
Official Symbol | TMEM9B |
Synonyms | C11orf15 |
Gene ID | 56674 |
mRNA Refseq | NM_020644.1 |
Protein Refseq | NP_065695.1 |
UniProt ID | Q9NQ34 |
◆ Recombinant Proteins | ||
TMEM9B-9442M | Recombinant Mouse TMEM9B Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM9B-1796HF | Recombinant Full Length Human TMEM9B Protein, GST-tagged | +Inquiry |
TMEM9B-458H | Recombinant Human TMEM9B Protein, GST-tagged | +Inquiry |
RFL29160MF | Recombinant Full Length Mouse Transmembrane Protein 9B(Tmem9B) Protein, His-Tagged | +Inquiry |
TMEM9B-10125Z | Recombinant Zebrafish TMEM9B | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM9B-921HCL | Recombinant Human TMEM9B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM9B Products
Required fields are marked with *
My Review for All TMEM9B Products
Required fields are marked with *
0
Inquiry Basket