Recombinant Full Length Mouse Transmembrane Protein 8A(Tmem8A) Protein, His-Tagged
Cat.No. : | RFL21693MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 8A(Tmem8a) Protein (Q9ESN3) (34-769aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (34-769) |
Form : | Lyophilized powder |
AA Sequence : | SNSKESEAGLVSEHFSQAPQKLSFYSWYGSTRLFHFRVPPDTVLLRWLLHVSQGSPSCTD EEITVHFRYGAPPVINPLGTSFPDNTLSHASFHIRALLSTLMLDNTSVNISHPAPGDWFL VAHLPPSSQKIQVKGFVPTCAYIFQPDMLVMRVVEVSTLEPDVPLPQTLLSYPSYLKIFV PEYTQELRLELQGCVSSVSPGCPVRVTVGATTLPRNFQRVLTCTGLAPSCHLLLSSPPWG RWLQVTFESLAEPHVTVGFTAKAVFTVCRPWSVTIHHLIQNNPNQTYDTSAIQLSQSAVH RDLGRSSRVDSGPFCLLNYPVLREDTDVVSVHFQPLNGAFVLVHSSMPSVMQLRLDTGMD SGGSFIIVLRTNKTEVTNGTLVAACVNAASPFLSFNTSLNCTTAFFQGYPMFLRASSHMA NLIMPFPETDNWYLSLQLVCPESPEDCEQAVVRVETILYLVPCLNDCGPYGQCLLLRRYG YVYAGCSCKAGWRGWSCTDNSTAQTVAQQRAAALLLTLSNLMFLAPIAISLHRSFLVEAS VYFYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGASTWVTILCMARLKTILKQV LLVLGTLVIAMSLQMDRRGIWNLMGPCVFAFVIMASMWIYRCGHRGQCYPTSWQRWVFYL LPGISMASVGIAMYTSMMTSDNYYYTHSIWHILLAGSAAFLLPPREEKAGSWACLQKFPC HYQICRNDRDELYTVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem8a |
Synonyms | Pgap6; Tmem8; Tmem8a; Post-GPI attachment to proteins factor 6; GPI processing phospholipase A2; GPI-PLA2; M83 protein; Transmembrane protein 8; Transmembrane protein 8A |
UniProt ID | Q9ESN3 |
◆ Recombinant Proteins | ||
BSG-613H | Recombinant Human BSG protein, mFc-tagged | +Inquiry |
CRBN-663HF | Recombinant Full Length Human CRBN Protein, GST-tagged | +Inquiry |
TARDBP-3114H | Recombinant Human TARDBP, His-tagged | +Inquiry |
RFL25944XF | Recombinant Full Length Xanthomonas Campestris Pv. Campestris Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
METTL20-3658R | Recombinant Rat METTL20 Protein | +Inquiry |
◆ Native Proteins | ||
LDHA-26867TH | Native Human LDHA | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
gG2-650V | Native Herpes Simplex Virus gG2 Protein | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
CDK6-7622HCL | Recombinant Human CDK6 293 Cell Lysate | +Inquiry |
COIL-7380HCL | Recombinant Human COIL 293 Cell Lysate | +Inquiry |
MAP4K3-4501HCL | Recombinant Human MAP4K3 293 Cell Lysate | +Inquiry |
AGPAT1-36HCL | Recombinant Human AGPAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem8a Products
Required fields are marked with *
My Review for All Tmem8a Products
Required fields are marked with *
0
Inquiry Basket