Recombinant Full Length Human Transmembrane Protein 8A(Tmem8A) Protein, His-Tagged
Cat.No. : | RFL25502HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 8A(TMEM8A) Protein (Q9HCN3) (35-771aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (35-771) |
Form : | Lyophilized powder |
AA Sequence : | GYSGKSEVGLVSEHFSQAPQRLSFYSWYGSARLFRFRVPPDAVLLRWLLQVSRESGAACT DAEITVHFRSGAPPVINPLGTSFPDDTAVQPSFQVGVPLSTTPRSNASVNVSHPAPGDWF VAAHLPPSSQKIELKGLAPTCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVF VPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVLTCTGAPWPCRLLLPSPPW DRWLQVTAESLVGPLGTVAFSAVAALTACRPRSVTIQPLLQSSQNQSFNASSGLLSPSPD HQDLGRSGRVDRSPFCLTNYPVTREDMDVVSVHFQPLDRVSVRVCSDTPSVMRLRLNTGM DSGGSLTISLRANKTEMRNETVVVACVNAASPFLGFNTSLNCTTAFFQGYPLSLSAWSRR ANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPCLNDCGPYGQCLLLRRH SYLYASCSCKAGWRGWSCTDNSTAQTVAQQRAATLLLTLSNLMFLAPIAVSVRRFFLVEA SVYAYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGAAIWVTILCMARLKTVLKY VLFLLGTLVIAMSLQLDRRGMWNMLGPCLFAFVIMASMWAYRCGHRRQCYPTSWQRWAFY LLPGVSMASVGIAIYTSMMTSDNYYYTHSIWHILLAGSAALLLPPPDQPAEPWACSQKFP CHYQICKNDREELYAVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM8A |
Synonyms | PGAP6; TMEM6; TMEM8; TMEM8A; Post-GPI attachment to proteins factor 6; GPI processing phospholipase A2; GPI-PLA2; Protein M83; Transmembrane protein 6; Transmembrane protein 8; Transmembrane protein 8A |
UniProt ID | Q9HCN3 |
◆ Recombinant Proteins | ||
OMP38-1751A | Recombinant Acinetobacter Baumannii OMP38 Protein (20-356 aa), His-tagged | +Inquiry |
birA-0762E | Recombinant E. coli (strain K12) birA Protein (Full Length), C-Strep tagged | +Inquiry |
IDH1-14047H | Recombinant Human IDH1, His-tagged | +Inquiry |
ELOA3DP-7547H | Recombinant Human ELOA3DP protein(270-429aa), His&Myc-tagged | +Inquiry |
Il1r1-883R | Recombinant Rat Il1r1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
Dimer-110H | Native Human D-Dimer Protein | +Inquiry |
GHRH-37H | Active Native Human GHRH | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPIC-1516HCL | Recombinant Human SPIC 293 Cell Lysate | +Inquiry |
PEA15-3312HCL | Recombinant Human PEA15 293 Cell Lysate | +Inquiry |
SIGLEC10-1849HCL | Recombinant Human SIGLEC10 293 Cell Lysate | +Inquiry |
PLOD3-1379HCL | Recombinant Human PLOD3 cell lysate | +Inquiry |
VTN-2062MCL | Recombinant Mouse VTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM8A Products
Required fields are marked with *
My Review for All TMEM8A Products
Required fields are marked with *
0
Inquiry Basket