Recombinant Full Length Mouse Transmembrane Protein 71(Tmem71) Protein, His-Tagged
Cat.No. : | RFL32053MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 71(Tmem71) Protein (Q149F5) (1-287aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-287) |
Form : | Lyophilized powder |
AA Sequence : | MYRDSPLMSTPVANDSRSDEGPSGKLSPTCLFPSFTCDFLDGDSSFECCSIDPLTGSHYI CRRSPRLLTNGYYIWTEDSFFCDPDGHITLNPSQTSVMYKENLVRIFRKKKRTHRSLSSL LDPRASKSWLHGSIFGEVDSLPSEDLWLDGIRSLGSDLDCSLSDGWESQKPVTDTSESSS SGYILPQSLRESSQSSSLQLQVKASGHFEKNSLVHSRAGLMHKVSFQAILLAVCLVISAY TRWFVGGELASIFTCALLITIAYVVKSLFLNLARYFKATSCARFDST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem71 |
Synonyms | Tmem71; Transmembrane protein 71 |
UniProt ID | Q149F5 |
◆ Recombinant Proteins | ||
FcgR3A-3280H | Recombinant Human FcgR3A protein, His-tagged | +Inquiry |
E6-1684H | Recombinant HPV-34 E6 Protein | +Inquiry |
CXCL17-4104M | Recombinant Mouse CXCL17 Protein | +Inquiry |
SNCA-293H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 1-60 | +Inquiry |
SAOUHSC-00691-3594S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00691 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
Thrombin-28B | Active Native Bovine alpha-Thrombin-DFP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PATZ1-3421HCL | Recombinant Human PATZ1 293 Cell Lysate | +Inquiry |
ANPEP-3000MCL | Recombinant Mouse ANPEP cell lysate | +Inquiry |
IL16-5245HCL | Recombinant Human IL16 293 Cell Lysate | +Inquiry |
NPR1-3733HCL | Recombinant Human NPR1 293 Cell Lysate | +Inquiry |
HIST1H2AJ-5545HCL | Recombinant Human HIST1H2AJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem71 Products
Required fields are marked with *
My Review for All Tmem71 Products
Required fields are marked with *
0
Inquiry Basket