Recombinant Full Length Human Transmembrane Protein 71(Tmem71) Protein, His-Tagged
Cat.No. : | RFL32040HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 71(TMEM71) Protein (Q6P5X7) (1-295aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-295) |
Form : | Lyophilized powder |
AA Sequence : | MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYT CRRSPRLLTNGYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSL FNLSTSKSWLHGSIFGDINSSPSEDNWLKGTRRLDTDHCNGNADDLDCSSLTDDWESGKM NAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQEVFFQAILL AVCLIISACARWFMGEILASVFTCSLMITVAYVKSLFLSLASYFKTTACARFVKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM71 |
Synonyms | TMEM71; Transmembrane protein 71 |
UniProt ID | Q6P5X7 |
◆ Recombinant Proteins | ||
PHLDA2-1688H | Recombinant Human PHLDA2, GST-tagged | +Inquiry |
CDC42EP2-939R | Recombinant Rat CDC42EP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT8A-2049HFL | Recombinant Full Length Human WNT8A protein, Flag-tagged | +Inquiry |
UBAC1-6045R | Recombinant Rat UBAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF11A-1333H | Recombinant Human TNFRSF11A Protein (Tyr76-Pro317), N-His tagged | +Inquiry |
◆ Native Proteins | ||
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
Arp 2/3 complex-856P | Native Porcine Arp 2/3 complex Protein | +Inquiry |
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJB7-6882HCL | Recombinant Human DNAJB7 293 Cell Lysate | +Inquiry |
ECSIT-241HCL | Recombinant Human ECSIT lysate | +Inquiry |
PDE4B-621HCL | Recombinant Human PDE4B cell lysate | +Inquiry |
TMEM57-940HCL | Recombinant Human TMEM57 293 Cell Lysate | +Inquiry |
OVCA2-3510HCL | Recombinant Human OVCA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM71 Products
Required fields are marked with *
My Review for All TMEM71 Products
Required fields are marked with *
0
Inquiry Basket