Recombinant Full Length Human Transmembrane Protein 232(Tmem232) Protein, His-Tagged
Cat.No. : | RFL6962HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 232(TMEM232) Protein (C9JQI7) (1-657aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-657) |
Form : | Lyophilized powder |
AA Sequence : | MNMPVNKSPMINTCGGISSPYHEELWKLNFQHLSGERGHKSRPTFSITKEFILRFNQTQN SKEKEELLELARKIILRCKRKLGLKTLGSGRHVHLPAAWTEVIYLAQCKGEIQDESLNML YASLDHASFDYDHLPALFFVAESVLYRLCCDASLKTYLYSVEIKLAKIGYLVFLRLFIFF LHGHLESFKQHLLRLQPYLYALSFSGASYHKYPNIFSNVQFILKASEIIGKRELRSESIF RPVEDKKRYENTDSDMGGYEINHLLWHCVAAWSCVQNNSPQLNNVLEHLVFHKTQLQKKC WLDSVLALLVLGEAAKLNMACLKALMDVVRDFVSSIMSVQNQEESCKVDDFSWAWNVVYI YTVILAEICLYAATSDLRKTALIGFCHCKSSQKNILYLDKSVPPELKETSILSLLEYFSS KMSENCDQVVWTGYYGLVYNLVKISWELQGDEEQDGLRNMIWQTLQKTKDYEEDVRIQNA INIAQAELNDPTDPFTRYSTNISSNVGEEVFSKYIGWRIANTLSKLFFPPIEAHFLPLKK PSIKKDQTKYPNKKLESVKKQVLHFTVREHPSVSEIPMFPYPDFFTKADKELAKIIDHHW QEELKIREKEDAICKAQELKDKKLAEKNHFQEVMKKREEKLHKQTKPYELPYRKEVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM232 |
Synonyms | TMEM232; Transmembrane protein 232 |
UniProt ID | C9JQI7 |
◆ Recombinant Proteins | ||
RFL33206SF | Recombinant Full Length Salmonella Typhimurium O-Antigen Ligase(Rfal) Protein, His-Tagged | +Inquiry |
PI4KB-4906H | Recombinant Human PI4KB Protein (Met1-Met801), C-His tagged | +Inquiry |
ADRA1A-86R | Recombinant Rhesus Macaque ADRA1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAC1-07H | Recombinant Human PLAC1 Protein | +Inquiry |
Luciferase-168F | Recombinant Firefly Luciferase Protein | +Inquiry |
◆ Native Proteins | ||
Trf-4782M | Native Mouse Transferrin | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2343HCL | Recombinant H11N9 HA cell lysate | +Inquiry |
PAF1-466HCL | Recombinant Human PAF1 lysate | +Inquiry |
INPP5E-862HCL | Recombinant Human INPP5E cell lysate | +Inquiry |
SmallIntestine-545E | Equine Small Intestine Lysate, Total Protein | +Inquiry |
TPM3-842HCL | Recombinant Human TPM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM232 Products
Required fields are marked with *
My Review for All TMEM232 Products
Required fields are marked with *
0
Inquiry Basket