Recombinant Full Length Mouse Transmembrane Protein 229A(Tmem229A) Protein, His-Tagged
Cat.No. : | RFL12662MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 229A(Tmem229a) Protein (B9EJI9) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MAGSDVASEGPSPRDGATRRPGATGGLRSQAAASCPEPLSAAEAPAERGALPAWMRLYFY GMHGITLDVLVSSARRFARSLDLRMLGFSSPYRCLLHSLTHFALEQLYLQRPRCPSAFLF NFLLYPSAHVGLQTLAGQALRLSLGGGPGGAAAPALGALDLALQYVLALYHGQVFLKRFL CLRYPRRRDQHTRDTLPAARDAQILWEAGGQRRGPGGARGTERSPTQGLPDLLRFLFFGM HGFLDEIFFTFFFNVLGQGDRASSGHTSLWSFFMYGSCSFVVEKLYFHLHYSRGWGTWKR VPIYVIFIYAWEFSWGLGLRMCGACSWDYSHYPLNFMGLITLMYLPGWLFLSVYQDLLSN VLWRVQYVPTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem229a |
Synonyms | Tmem229a; Transmembrane protein 229A |
UniProt ID | B9EJI9 |
◆ Recombinant Proteins | ||
RCVRN-3835R | Recombinant Rhesus monkey RCVRN Protein, His-tagged | +Inquiry |
LGR5-1624H | Recombinant Human LGR5 protein, hFc-tagged | +Inquiry |
CLDN3-895R | Recombinant Rhesus monkey CLDN3 Protein, His-tagged | +Inquiry |
IFNB1-242C | Recombinant Chicken IFNB1 Protein, His-tagged | +Inquiry |
RFL13517YF | Recombinant Full Length Yersinia Pestis Bv. Antiqua Upf0266 Membrane Protein Ypa_1127(Ypa_1127) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
Neuraminidase-009C | Active Native Clostridium perfringens Neuraminidase, Type VIII | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Adipose-409R | Rat Adipose Lysate | +Inquiry |
FCRL4-6274HCL | Recombinant Human FCRL4 293 Cell Lysate | +Inquiry |
PTN-001MCL | Recombinant Mouse PTN cell lysate | +Inquiry |
MBL2-001HCL | Recombinant Human MBL2 cell lysate | +Inquiry |
CSAG1-1615HCL | Recombinant Human CSAG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem229a Products
Required fields are marked with *
My Review for All Tmem229a Products
Required fields are marked with *
0
Inquiry Basket