Recombinant Full Length Human Transmembrane Protein 229A(Tmem229A) Protein, His-Tagged
Cat.No. : | RFL10680HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 229A(TMEM229A) Protein (B2RXF0) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MAGSDVDSEGPARRGGAARRPGAPGGPGSEAAAGCPEPLSTAEAPAESATLPAWMRLYFY GMHGITLDVLVSSARRFARSPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVF NFLLYPSAHVGLQTLAGQALLLSLGGGAGVAVAPGALDLALQYVLALYHCQVFLKRFLRL RYGRQRRRQQQQQQQQQQQQRRGALPVPPGARVPTAAGARRRRPRGPRGAGGAPSQGLPD LPRFLFFGMHGFLDEIFFTFFFNVLGQGDGTTSGHTSLWSFFMYGSCSFVVEKLYFHLHY SRGWGTWKRVPIYVIFIYVWELSWGLGLRTCGACSWDYSHYPLNFMGLITLMYLPGWIFL SVYQDLISNVLWRVQYVPAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM229A |
Synonyms | TMEM229A; Transmembrane protein 229A |
UniProt ID | B2RXF0 |
◆ Recombinant Proteins | ||
RFL12446HF | Recombinant Full Length Human Herpesvirus 6A Protein U17(U17/U16) Protein, His-Tagged | +Inquiry |
BPNT1-667R | Recombinant Rat BPNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POGK-3500R | Recombinant Rhesus monkey POGK Protein, His-tagged | +Inquiry |
ST8SIA6-1122C | Recombinant Chicken ST8SIA6 | +Inquiry |
KIR2DL1-145H | Recombinant Human KIR2DL1 | +Inquiry |
◆ Native Proteins | ||
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2I-574HCL | Recombinant Human UBE2I 293 Cell Lysate | +Inquiry |
ARHGEF28-540HCL | Recombinant Human ARHGEF28 lysate | +Inquiry |
FAM119B-6443HCL | Recombinant Human FAM119B 293 Cell Lysate | +Inquiry |
Olfactory (region)-37H | Human Olfactory (Region) Tissue Lysate | +Inquiry |
ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM229A Products
Required fields are marked with *
My Review for All TMEM229A Products
Required fields are marked with *
0
Inquiry Basket