Recombinant Full Length Mouse Transmembrane Protein 183(Tmem183) Protein, His-Tagged
Cat.No. : | RFL29311MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 183(Tmem183) Protein (Q9JJB9) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MARGSGQLGGPHRDTVTMPKRGKRLKFRAHDACSGRVTVADYANSDPAVVRSGRVKKAVA NAIQQEVKSLCGLEASQVPAEEALSGVGEPCDILDSSDEMDAQEESTQERSVSRKKKSKR HKEDPDGTGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLD ASLPLRLRPESMEKLRCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFW CRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMERLQPPIQYQDVHTNPDQDCCLLQVTTLN FIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVRGGQNLRSEQGVQVVLDPVHSVR LFDWWHPQYPFSLRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem183 |
Synonyms | Tmem183; Tmem183a; MNCb-2755; Transmembrane protein 183 |
UniProt ID | Q9JJB9 |
◆ Recombinant Proteins | ||
PCSK9-186H | Active Recombinant Human PCSK9, His-tagged, Biotinylated | +Inquiry |
C3AR1-3499H | Recombinant Human C3AR1 protein, His-tagged | +Inquiry |
IL5-27607TH | Recombinant Human IL5 protein, His-tagged | +Inquiry |
RAF1-551H | Active Recombinant Human RAF1, GST-tagged | +Inquiry |
KRT83-6100HF | Recombinant Full Length Human KRT83 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAP1A-2529HCL | Recombinant Human RAP1A 293 Cell Lysate | +Inquiry |
COX7B2-7324HCL | Recombinant Human COX7B2 293 Cell Lysate | +Inquiry |
SLITRK1-2848HCL | Recombinant Human SLITRK1 cell lysate | +Inquiry |
PDE2A-591HCL | Recombinant Human PDE2A cell lysate | +Inquiry |
IRX2-873HCL | Recombinant Human IRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem183 Products
Required fields are marked with *
My Review for All Tmem183 Products
Required fields are marked with *
0
Inquiry Basket