Recombinant Full Length Bovine Transmembrane Protein 183(Tmem183) Protein, His-Tagged
Cat.No. : | RFL20055BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 183(TMEM183) Protein (Q5EA86) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MARGPGPLTRPRPDTVAMPKRGKRLKFRAQDACSGRVTVADYANSDPAVVRSGRVKKAVA NAVQQEVKSLCGLEASQVPAVEALSGAGEPCDIIDSSGETDAQEESIHERTISRKKKSKR HREDLNGTGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTL DASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLF WCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCMGGLQPPIQYEDVHTNPDQDCCLLQVTTL NFIFIPIVMGMIFTLFTISVSTDMRHHRVRLVFQDYPVHGGQKLRSEQGVQVILDPVHSV RLFDWWHPQYPFSLRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM183 |
Synonyms | TMEM183; Transmembrane protein 183 |
UniProt ID | Q5EA86 |
◆ Recombinant Proteins | ||
SOCS5-3841C | Recombinant Chicken SOCS5 | +Inquiry |
MMP10-440H | Recombinant Human matrix metallopeptidase 10 (stromelysin 2), His-tagged | +Inquiry |
CNOT6-3668M | Recombinant Mouse CNOT6 Protein | +Inquiry |
NR4A2-2451H | Recombinant Human NR4A2 Protein (1-598 aa), His-tagged | +Inquiry |
PCP4-4056H | Recombinant Human PCP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
HPX-29307TH | Native Human HPX | +Inquiry |
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
PLG-27925TH | Native Human PLG | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6ST-946CCL | Recombinant Cynomolgus IL6ST cell lysate | +Inquiry |
ZNF560-51HCL | Recombinant Human ZNF560 293 Cell Lysate | +Inquiry |
ERBB4-1417MCL | Recombinant Mouse ERBB4 cell lysate | +Inquiry |
HRSP12-5390HCL | Recombinant Human HRSP12 293 Cell Lysate | +Inquiry |
RIOK1-001HCL | Recombinant Human RIOK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM183 Products
Required fields are marked with *
My Review for All TMEM183 Products
Required fields are marked with *
0
Inquiry Basket