Recombinant Full Length Mouse Transmembrane Protein 107(Tmem107) Protein, His-Tagged
Cat.No. : | RFL19143MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 107(Tmem107) Protein (Q9CPV0) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MGRISGLVPSRFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLT LGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAF PAVTETALFIAVFGLKKKPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem107 |
Synonyms | Tmem107; Transmembrane protein 107 |
UniProt ID | Q9CPV0 |
◆ Recombinant Proteins | ||
RFL19568VF | Recombinant Full Length Vibrio Cholerae Serotype O1 Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
SECP43-5305R | Recombinant Rat SECP43 Protein | +Inquiry |
TUBA1A-3184H | Recombinant Human TUBA1A protein, His-tagged | +Inquiry |
C5-0293M | Recombinant Mouse C5 protein | +Inquiry |
TF-4778H | Human Transferrin | +Inquiry |
◆ Native Proteins | ||
HPX-84R | Native Rat Hemopexin | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIAPH1-6925HCL | Recombinant Human DIAPH1 293 Cell Lysate | +Inquiry |
GAGE1-6050HCL | Recombinant Human GAGE1 293 Cell Lysate | +Inquiry |
CCDC74A-7749HCL | Recombinant Human CCDC74A 293 Cell Lysate | +Inquiry |
SOHLH2-1667HCL | Recombinant Human SOHLH2 cell lysate | +Inquiry |
FAM122A-583HCL | Recombinant Human FAM122A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem107 Products
Required fields are marked with *
My Review for All Tmem107 Products
Required fields are marked with *
0
Inquiry Basket