Recombinant Full Length Mouse Transient Receptor Potential Cation Channel Subfamily V Member 6(Trpv6) Protein, His-Tagged
Cat.No. : | RFL5657MF |
Product Overview : | Recombinant Full Length Mouse Transient receptor potential cation channel subfamily V member 6(Trpv6) Protein (Q91WD2) (1-727aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-727) |
Form : | Lyophilized powder |
AA Sequence : | MGWSLPKEKGLILCLWNKFCRWFHRQESWAQSRDEQNLLQQKRIWESPLLLAAKENDVQA LSKLLKFEGCEVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTA LHIAVINQNVNLVRALLARGASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVR LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGL TPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGDDQSLLELIVTTKK REARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTN PRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTIL GGPFHVIIITYAFMVLVTMVMRLTNVDGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIM IQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTII DGPANYDVDLPFMYSVTYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVATT VMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIRRYAQAFQQQDGLYSED LEKDSGEKLETARPFGAYLSFPTPSVSRSTSRSSTNWERLRQGALRKDLRGIINRGLEDG EGWEYQI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Trpv6 |
Synonyms | Trpv6; Transient receptor potential cation channel subfamily V member 6; TrpV6; Calcium transport protein 1; CaT1; Epithelial calcium channel 2 |
UniProt ID | Q91WD2 |
◆ Recombinant Proteins | ||
PSK41-P13-4021S | Recombinant Staphylococcus aureus PSK41_P13 protein, His-tagged | +Inquiry |
NRIP2-10891M | Recombinant Mouse NRIP2 Protein | +Inquiry |
PKSH-1637B | Recombinant Bacillus subtilis PKSH protein, His-tagged | +Inquiry |
SNX17-4188Z | Recombinant Zebrafish SNX17 | +Inquiry |
YVKA-1826B | Recombinant Bacillus subtilis YVKA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDR2-1017CCL | Recombinant Cynomolgus DDR2 cell lysate | +Inquiry |
APOH-2543HCL | Recombinant Human APOH cell lysate | +Inquiry |
SHE-1858HCL | Recombinant Human SHE 293 Cell Lysate | +Inquiry |
HAVCR1-2141HCL | Recombinant Human HAVCR1 cell lysate | +Inquiry |
RTKN-2124HCL | Recombinant Human RTKN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Trpv6 Products
Required fields are marked with *
My Review for All Trpv6 Products
Required fields are marked with *
0
Inquiry Basket