Recombinant Full Length Mouse Trans-2,3-Enoyl-Coa Reductase-Like(Tecrl) Protein, His-Tagged
Cat.No. : | RFL12635MF |
Product Overview : | Recombinant Full Length Mouse Trans-2,3-enoyl-CoA reductase-like(Tecrl) Protein (Q8BFZ1) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MFKRHKSLERKRELLFQGLPQSTMKNNARNFHSLSQLVLSAGPLKTTTAVKHSKTTHFEI EILDAHTRKQICIVDKVTQTSTIHDVKQKFHKACPKWYPSRIGLQLEYGGPYLRDYITVQ SVAASSIITLYFTDLGQQVGWTTVFLAEYSGPLLIYLLFYLRSSYIYDVKESTRWPRHPV VHLAFFCHCIHYIRLLLETLFVHKVSTGHSPMKNLIKGCAFYWGFTSWMAYYINHPRYTP PSFGNRQVIVSAINFLFCEAGNHFINTVLAHPNHTGSNACFPSPNYNPFTWLFFLVSCPN YTYEIGSWISFTVMTQTLPVGIFTILMTIQMSLWARKKHKIYRKKFNSYVHRKSAIIPLI L |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tecrl |
Synonyms | Tecrl; Srd5a2l2; Trans-2,3-enoyl-CoA reductase-like; Steroid 5-alpha-reductase 2-like 2 protein |
UniProt ID | Q8BFZ1 |
◆ Recombinant Proteins | ||
TPH1-5896R | Recombinant Rat TPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD4-1358H | Recombinant Human ENTPD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SOX-2-9491Z | Recombinant Zebrafish SOX-2 | +Inquiry |
SHH-275H | Active Recombinant Human SHH Protein (Gly25-Gly197, C24II), Animal-free, Carrier-free | +Inquiry |
KCTD1-0656H | Recombinant Human KCTD1 Protein (S2-D257), Tag Free | +Inquiry |
◆ Native Proteins | ||
Mannose Binding Lectin-044H | Native Human Mannose Binding Lectin Protein | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-1953HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
HA-1951HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
LILRB1-774HCL | Recombinant Human LILRB1 cell lysate | +Inquiry |
ZNF222-117HCL | Recombinant Human ZNF222 293 Cell Lysate | +Inquiry |
Liver-290H | Human Liver Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tecrl Products
Required fields are marked with *
My Review for All Tecrl Products
Required fields are marked with *
0
Inquiry Basket