Recombinant Full Length Bovine Trans-2,3-Enoyl-Coa Reductase-Like(Tecrl) Protein, His-Tagged
Cat.No. : | RFL36331BF |
Product Overview : | Recombinant Full Length Bovine Trans-2,3-enoyl-CoA reductase-like(TECRL) Protein (Q3SZ89) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MFKRHKSLASERRRELISRGATRSILKDDMKNFHFLSQFILSAGPLKSTSAVKHSKTIHF EIEILDAQTKKQICIVDKVTQKSTIHDVKQKFHKACPQWYPSRVGLQLERGGPFLKDNLT IQSVAASSIVTLYFTDLGQQVSWTTVFLAEYTGPLLIYLLFYLRIPYIYNMKESSRRLCH PVVHLACFCHCIHYIRYLLETLFVHKVSSGHTSLKNLLKSCAFYWGFTSWIAYYINHPRY TPPSFGYRQVAISAINFLICEAGNHFINVVLSHPSHTGNNACFPSPNYNPFTWMFFLVSC PNYTYEIGSWISFTIMTQTLPVGIFTLLMSIQMSLWAKKKHKIYLKKFSSYMHRKSAMIP FIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TECRL |
Synonyms | TECRL; SRD5A2L2; Trans-2,3-enoyl-CoA reductase-like; Steroid 5-alpha-reductase 2-like 2 protein |
UniProt ID | Q3SZ89 |
◆ Recombinant Proteins | ||
HRH2-1964R | Recombinant Rhesus Macaque HRH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UTP15-4947R | Recombinant Rhesus Macaque UTP15 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR38-5011R | Recombinant Rhesus Macaque WDR38 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP2C8-384H | Recombinant Human CYP2C8 | +Inquiry |
Wipf1-7002M | Recombinant Mouse Wipf1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
Serpinc1-5485M | Native Mouse Serpin (or cysteine) Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN3KRP-6176HCL | Recombinant Human FN3KRP 293 Cell Lysate | +Inquiry |
ATP6V1G2-8576HCL | Recombinant Human ATP6V1G2 293 Cell Lysate | +Inquiry |
CPLX1-7313HCL | Recombinant Human CPLX1 293 Cell Lysate | +Inquiry |
NUP50-3629HCL | Recombinant Human NUP50 293 Cell Lysate | +Inquiry |
NEGR1-2116MCL | Recombinant Mouse NEGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TECRL Products
Required fields are marked with *
My Review for All TECRL Products
Required fields are marked with *
0
Inquiry Basket